Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-b (FCGR2B)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b (FCGR2B) is a genetically engineered form of the inhibitory Fc gamma receptor IIB, a key immune checkpoint protein that modulates antibody-mediated immune responses. This receptor binds the Fc region of immunoglobulin G (IgG) with low affinity and regulates cellular activation by counteracting signals from activating FcγRs or the B cell receptor (BCR) . Recombinant FCGR2B is widely used in research to study autoimmune diseases, cancer immunotherapy, and infectious disease mechanisms .

Protein Architecture

  • Domains: Contains two extracellular immunoglobulin-like domains, a transmembrane region, and a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM) .

  • Isoforms: Two major splice variants exist:

    • FCGR2B1: Includes a C1 exon, enabling membrane retention in B cells.

    • FCGR2B2: Lacks C1, leading to rapid internalization in myeloid cells .

FeatureFCGR2B1FCGR2B2
ExpressionB cellsMyeloid cells
Half-life at membraneLong (~8 hours)Short (~30 minutes)
FunctionInhibits BCR signalingPhagocytosis regulation

Recombinant Production

  • Expression Systems: Typically produced in CHO-K1 cells, with confirmed surface expression via flow cytometry .

  • Molecular Weight: ~34 kDa (glycosylated) .

Functional Mechanisms

FCGR2B suppresses immune activation through:

  • ITIM Phosphorylation: Recruits SHIP1/2 phosphatases, inhibiting MAPK, PLCγ, and PKC pathways .

  • Co-localization Dynamics: Competes with activating receptors (e.g., FCGR2A) for immune complex binding, reducing pro-inflammatory cytokine release .

  • B Cell Regulation: Raises the activation threshold for BCR, promoting apoptosis of autoreactive B cells .

Key Pathways:

  1. Inhibition of BCR/CD19 microcluster formation.

  2. Attenuation of dendritic cell maturation .

Clinically Relevant Variants

PolymorphismFunctional ImpactDisease Association
p.Ile232Thr (TM domain)Reduced lipid raft localizationSLE, RA susceptibility
Promoter −343G>CDecreased transcription (AP1 binding loss)SLE progression
Promoter −386C/−120AEnhanced FcGR2B expressionMalaria resistance

Role in Cancer and Autoimmunity

  • Glioma Prognosis: High FCGR2B expression correlates with poor survival (AUC = 0.81 at 5 years) and immune infiltration (p < 0.001) .

  • Autoimmunity: Reduced FCGR2B expression or function permits unchecked B cell activation, driving autoantibody production in SLE and RA .

ELISA Kits

ParameterSpecification
Sensitivity0.13 ng/ml
Detection Range0.3–90 ng/ml
Sample TypesSerum, plasma, supernatants

Components: Pre-coated plates, biotinylated antibodies, streptavidin-HRP .

Therapeutic Targeting

  • Antibody Checkpoint Therapy: Co-engagement of FCGR2B enhances anti-tumor T cell responses by promoting dendritic cell maturation .

  • B Cell Malignancies: FCGR2B blockade augments antibody-dependent cellular cytotoxicity (ADCC) .

Clinical and Experimental Findings

  • Dengue Infection: FCGR2B inhibits antibody-dependent enhancement (ADE) by blocking viral entry via ITIM signaling .

  • Glioma Microenvironment: FCGR2B-high tumors exhibit elevated macrophage infiltration (r = 0.62, p = 0.003) and PD-L1 expression .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will prepare the protein accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the most accurate delivery timeline.
Note: All proteins are shipped with standard blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing aliquots at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is typically 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
FCGR2B; CD32; FCG2; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-b; IgG Fc receptor II-b; CDw32; Fc-gamma RII-b; Fc-gamma-RIIb; FcRII-b; CD antigen CD32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-310
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
Uniprot No.

Target Background

Function
FcgammaRIIb (CD32b) is a receptor for the Fc region of complexed or aggregated immunoglobulins gamma. It exhibits low affinity and is involved in a variety of effector and regulatory functions, including phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to FcgammaRIIb leads to down-modulation of previous cell activation states triggered by antigen receptors on B-cells (BCR), T-cells (TCR), or other Fc receptors. Isoform IIB1 does not mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
Gene References Into Functions

Relevant Research on FcgammaRIIb:

  1. Data indicate that patients with low FcgammaRIIb expression required therapy earlier than those with high FcgammaRIIb expression. PMID: 28372509
  2. This genome-wide association study of cyclophosphamide response in lupus nephritis patients revealed a robust profile of genetic associations, including a large-effect SNP in the FCGR2B-FCRLA locus. This finding may provide insights into cyclophosphamide metabolism and efficacy. PMID: 26980576
  3. Fc receptors trans-inhibit activation and proliferation signals in mast cells and basophils. PMID: 27999175
  4. Research suggests that abnormal B cell subset distribution and decreased CD32b expression on DN memory cells might contribute to the pathogenesis of Hashimoto's thyroiditis. PMID: 27832986
  5. The single-residue polymorphism T232 enforces the inclination of the transmembrane domain, reducing the lateral mobility and inhibitory functions of FcgammaRIIB. PMID: 27799621
  6. Results indicate that FcgammaRIIB does not solely promote membrane recruitment of SHIP, but instead modulates its function by forming distinct signaling complexes. Membrane recruitment of SHIP through Syk-dependent mechanisms might be a significant factor in modulating immunoreceptor signaling. PMID: 27456487
  7. Fc gamma receptor IIb was found to be significantly elevated in abdominal aortic aneurysm (AAA) tissues compared to normal aortas. Fc gamma receptor IIb may contribute to the pathogenesis of AAA by regulating inflammatory reactions. PMID: 28223220
  8. This study demonstrates that decreased FcgRIIb expression on monocytes may contribute to the development of coronary artery lesions in patients with Kawasaki disease. PMID: 28147297
  9. Data indicate that IgG2 Y296F variant exhibited decreased binding for FcgammaRIIb. PMID: 23628091
  10. LPS activation of TLR4 significantly increased MARCH3 expression, and siRNA against MARCH3 prevented the decrease in FcgammaRIIb following LPS treatment. PMID: 26694610
  11. A rare FCGR2B null-variant allele was discovered, in which a polymorphic stop codon of FCGR2C is introduced into one FCGR2B gene. PMID: 26133275
  12. FcgammaRIIB requires Btk and p38 MAPK to mediate antigen-independent inhibition in human B cells. PMID: 26475492
  13. The FCGR2B variant leads to reduced serum IL-6, later disease onset, and reduced need for biological treatment, but does not appear to worsen RA. The TM region variant is associated with a lower activation state of Tregs, naive, and memory B cells. PMID: 25630523
  14. FcgammaRIIB rs12117530 polymorphism is associated with disease risk and clinical manifestations of Systemic Lupus Erythematosus in Koreans. PMID: 26084639
  15. Increased serum levels are implicated in aberrant immune responses in systemic sclerosis. PMID: 25346304
  16. FcgIIb on GM-CSF macrophages plays a role in controlling immune complex-mediated inhibition of inflammatory signals. PMID: 25340460
  17. None of the three functional polymorphisms in FcgammaR genes investigated, the FCGR3A F158V and FCGR2B I232T nsSNPs, and the VNTR in FCGRT, showed an association with the response to TNFi in patients with rheumatoid arthritis. PMID: 25823782
  18. The FCGR2B inhibitory gene may predict the benefit of adjuvant trastuzumab in HER2+ breast cancer patients. PMID: 24989892
  19. FcgammaRIIB prevents inflammatory type I IFN production from plasmacytoid dendritic cells during a viral memory response. PMID: 25821224
  20. The study provides evidence that FcgammaRs, particularly FcgammaRIIB, are involved in the pathogenesis of Hashimoto's thyroiditis. PMID: 25670392
  21. Variants in FcgRIIB might play a role in the development of Lupus through their roles in apoptosis or debris clearance. PMID: 25034154
  22. Cross-linking by FcgammaRIIb is critical for the superagonist activity of TGN1412 after high-density preculture. PMID: 25395427
  23. Data indicate that inhibition of phagocytosis by IVIg is independent of IgG-Fc-sialylation and does not require an increase in fc-gamma-RIIb (FcgammaRIIb) expression. PMID: 25352126
  24. Co-engagement of FcgammaRIIb and CD19 by antibodies suppresses innate and adaptive B cell activation pathways. PMID: 24828435
  25. Data indicate that the lentiviral expression vector for FcgammaRIIB was successfully prepared, and its expression in HT-1080 cells is controllable through adjustments in doxycycline (Dox) concentration. PMID: 24909272
  26. No significant difference was found in pretransplant panel reactive antibodies, acute rejection at 1-year, or 10-year transplant or patient survival in individuals with differing FcgammaRIIB-I/T232 genotype. PMID: 25022320
  27. The study observed a decreased FcgammaRIIb1 translocation to lipid rafts and reduced tyrosine-phosphorylated FcgammaRIIb1. PMID: 24405601
  28. This inhibitory function of FcgammaRIIB in impairing the spatial-temporal colocalization of BCR and CD19 microclusters in the B cell immunological synapse may explain the hyper-reactive features of systemic lupus erythematosus. PMID: 24790152
  29. These data demonstrate that CD19 and CD32b differentially inhibit B cell expansion and plasma cell differentiation, depending on the nature of the activating stimuli, when engaged with monospecific Abs. PMID: 24442430
  30. T cells mount rapid TGN1412 responses, which are significantly boosted by FcgammaR crosslinking, particularly by CD32-expressing B cells. These results establish HDC-PBMCs as a valuable in vitro test system for analyzing complex mAb functions. PMID: 24470499
  31. FCGR2B and FCGR1B enhance the internalization of monoclonal antibodies on the surface of B cells. PMID: 24227819
  32. Memory CD8 T cells intrinsically express a functional FcgammaRIIB, enabling Ag-Ab complexes to regulate secondary CD8 T cell responses. PMID: 24285839
  33. Lower expression of FCGRIIB is likely involved in the etiology of ITP. HP infection is correlated with decreased expression of FCGRIIB. PMID: 23054650
  34. Data suggest that Fcgamma receptor IIB (FcgammaRIIB) 232I/T polymorphisms may play a crucial role in susceptibility to H pylori-infected immune thrombocytopenia (ITP) and in platelet responses following H pylori eradication in ITP patients. PMID: 24030263
  35. The objective of this study was to associate multiple polymorphisms within the FCGR gene locus with IgA nephropathy in a large Chinese cohort. PMID: 23593433
  36. FcgammaRIIb has an aberrant but essential role in amyloid beta-mediated neuronal dysfunction. PMID: 23921129
  37. Our data revealed that downregulation of CD32B on B cells from patients with rheumatoid arthritis is mediated by CD40-CD40L interactions. PMID: 23686494
  38. Maternal FcgammaRIIB-nt645+25A/G polymorphism and subgingival DNA level of A. actinomycetemcomitans were significantly associated with the prevalence of preeclampsia in a limited number of Japanese women. PMID: 22594540
  39. Compared to the mouse system, human monomeric IgG subclasses have an even smaller affinity for low-affinity FcgammaRIIA, FcgammaRIIB, and FcgammaRIIIA, making it challenging to obtain precise data. PMID: 23509345
  40. FcgammaRIIb on myeloid cells of bone marrow chimeric mice plays a significant role in their protection from nephrotoxic nephritis. PMID: 23203925
  41. We conclude that FCGR3B deletion juxtaposes the 5'-regulatory sequences of FCGR2C with the coding sequence of FCGR2B. PMID: 23261299
  42. FcgammaRIIB might play a crucial role in the central nervous system infection by Cryptococcus in HIV-uninfected individuals. PMID: 22879986
  43. CRP antagonism of eNOS is mediated by coupling of FcgammaRI to FcgammaRIIB by Src kinase and activation of inositol 5'-phosphatase 1, and consistent with this mechanism, both FcgammaRI and FcgammaRIIB are required for CRP to blunt endothelial repair in vivo. PMID: 21940940
  44. Activation of FasL is dependent on glucuronoxylomannan interaction with FcgammaRIIB;results highlight a fast track to FasL up-regulation via FcgammaRIIB and assign to this receptor an anti-inflammatory role that also accounts for induced peripheral tolerance. PMID: 21605112
  45. These findings suggest that FcgammaRIIB-nt645+25AA carriers are more likely to experience preterm birth than FcgammaRIIB-nt645+25AG and GG carriers. Additionally, women with FcgammaRIIB-nt645+25G exhibited a greater tendency to have periodontitis than those with nt645+25A. PMID: 21338356
  46. Peritoneal B1 cells express the highest levels of transgenic FcgammaRIIb among B cell subsets. PMID: 22516957
  47. FCGR2B rs10917661 may be a novel Single-nucleotide polymorphism involved in ankylosing spondylitis genetic predisposition in the Han Chinese population. PMID: 22416796
  48. The higher expression levels of FcgammaRIIb in subjects with the FcgammaRIIB-nt645+25AA genotype may induce a lower level of production of IgG against P. gingivalis and therefore more severe periodontitis. PMID: 21906057
  49. Data suggest that rituximab induces apoptosis of malignant B lymphocytes by stimulating FcgammaRIIB receptors and inhibiting Kv1.3 channels. PMID: 22192444
  50. The R allele of the FcgammaRIIa polymorphism is associated with impaired endothelium-dependent vasodilatation and reduced NO activity during endothelial cell stimulation. PMID: 21813128

Show More

Hide All

Database Links

HGNC: 3618

OMIM: 152700

KEGG: hsa:2213

STRING: 9606.ENSP00000351497

UniGene: Hs.654395

Involvement In Disease
Systemic lupus erythematosus (SLE)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells.

Q&A

What is FCGR2B and what are its primary functions in the immune system?

FCGR2B (CD32B) is a receptor for the Fc region of immunoglobulin G (IgG) and functions as an immune antibody checkpoint. It serves as a negative regulator of signals induced by antibodies bound to antigens at the surface of cells. The primary biological functions of FCGR2B include:

  • Modulating antibody-dependent inflammatory responses

  • Clearing the circulation of spent immune complexes

  • Inducing phagocytosis of aggregated immunoglobulins

  • Regulating B cell activation through B Cell Receptor (BCR) signaling

  • Acting as a "sink" for the removal of IgG immune complexes in airways and liver endothelial cells

As the only known negative regulator of BCR-induced activation of B cells, FCGR2B plays a critical role in maintaining immune homeostasis, with defects in its signaling leading to overt inflammation and contributing to autoimmune diseases .

What are the major isoforms of FCGR2B and how do they differ functionally?

There are two major forms of FCGR2B: FCGR2B1 and FCGR2B2, which arise from alternative mRNA splicing:

IsoformExon C1 StatusPrimary ExpressionFunctional Characteristics
FCGR2B1Includes exon C1B cellsTethered to membrane with longer half-life at cell surface
FCGR2B2Excludes exon C1Myeloid cellsUndergoes rapid internalization upon ligand binding

The presence of the C1 sequence in isoform 1 dramatically increases its half-life at the cell surface. In contrast, the absence of C1 in isoform 2 triggers rapid internalization of the receptor when ligand binding occurs. This structural difference results in distinct cellular functions, with FCGR2B1 primarily regulating B cell responses and FCGR2B2 facilitating endocytosis in myeloid cells .

How are FCGR2B-expressing recombinant cell lines generated and validated for research?

Generating stable FCGR2B-expressing recombinant cell lines typically involves the following methodology:

  • Selection of an appropriate host cell line (e.g., CHO-K1 cells)

  • Transfection with a vector containing the full-length human FCGR2B gene (Genbank #NM_004001.4)

  • Selection of stable transfectants using antibiotic resistance

  • Validation of cell surface expression using flow cytometry

  • Screening to confirm the absence of contamination (e.g., Mycoplasma)

Commercial cell lines, such as FcGR2B CHO K1 Recombinant Cell Line, are maintained in specific media compositions (e.g., Thaw Medium 3 and Growth Medium 3D) and preserved in 10% DMSO in FBS for long-term storage .

For functional assays, these cells can be co-cultured with reporter cell lines (such as CD137/NF-κB HEK293 cells) along with anti-CD137 recombinant human antibodies to evaluate FCGR2B-mediated effects on signaling pathways .

What methodologies are used to study FCGR2B-mediated signaling in lymphocytes?

Investigating FCGR2B-mediated signaling requires multiple complementary approaches:

  • Binding assays: Using recombinant ligands (e.g., Fgl2) with FCGR2B-expressing cells, with or without FcR-blocking antibodies (e.g., 2.4G2) to confirm specificity

  • Genetic approaches: Comparing responses between wild-type and Fcgr2b−/− cells to establish receptor-dependent effects

  • Apoptosis assays: Measuring caspase 3/7 activation and 7-AAD staining following stimulation with FCGR2B ligands

  • Phosphorylation studies: Monitoring inhibitory signaling cascades by examining phosphorylation of downstream effectors like SHIP, SHP-1, and negative regulation of PI3K/Akt pathways

  • Transcriptional analysis: Assessing expression changes in genes regulated by FCGR2B signaling using RNA-seq or qPCR

For example, research has demonstrated that Fgl2 serves as a functional ligand for FCGR2B on CD8+ T cells, resulting in increased frequency of active caspase 3/7+ 7-AAD+ cells among wild-type CD8+ T cells but not among Fcgr2b−/− CD8+ T cells, confirming the receptor-specific induction of apoptosis .

How does FCGR2B expression correlate with clinical outcomes in cancer patients?

FCGR2B expression has significant associations with clinical outcomes, particularly in glioma patients:

These findings suggest that FCGR2B could serve as a valuable prognostic biomarker in glioma and potentially other cancers, providing information beyond traditional clinical parameters .

What is the relationship between FCGR2B expression and the tumor immune microenvironment?

FCGR2B significantly impacts the tumor immune microenvironment through several mechanisms:

  • Immune score correlation: FCGR2B expression shows a significant positive correlation with immune scores in tumors, with higher expression associated with immunosuppressive environments

  • Immune checkpoint association: FCGR2B expression positively correlates with multiple immune checkpoint molecules including CD28, CD44, TNFSF14, PDCD1LG2, LAIR1, and CD48

  • Tumor mutation burden: Higher FCGR2B expression significantly correlates with increased tumor mutation load, suggesting a potential role in tumor evolution and immune evasion

  • Immune cell infiltration: FCGR2B expression affects the profile of tumor-infiltrating immune cells, influencing the balance between anti-tumor and pro-tumor immune responses

  • Immunosuppressive function: FCGR2B may contribute to tumor progression by enhancing immunosuppression in the tumor microenvironment, hampering effective anti-tumor immune responses

Gene ontology and gene set enrichment analyses confirm that FCGR2B is closely associated with immune-related functions in the tumor context, potentially making it a valuable target for immunotherapeutic approaches .

How does FCGR2B affect therapeutic antibody efficacy and what strategies exist to overcome FCGR2B-mediated resistance?

FCGR2B plays a dual role in therapeutic antibody efficacy:

  • Negative impact on antibody therapy:

    • Accelerates antibody depletion from circulation

    • Decreases B cell responses and antibody production

    • Can mediate resistance to antibody-based therapeutics

  • Positive contribution:

    • Contributes to anti-tumor responses to antibody checkpoint therapy

    • Boosts CD8+ T cells through cross-linking of antibodies directed at stimulatory checkpoints (4-1BB, OX40, CD40, GITR)

Strategies to overcome FCGR2B-mediated resistance include:

  • Fc engineering: Modifying the Fc region of therapeutic antibodies to reduce FCGR2B binding while maintaining engagement with activating FcγRs

  • Combination therapy: Using FCGR2B-blocking antibodies alongside therapeutic antibodies

  • Targeted delivery: Developing approaches that bypass FCGR2B-mediated clearance mechanisms

  • Bispecific antibodies: Designing antibodies that can simultaneously block FCGR2B while engaging therapeutic targets

These approaches aim to enhance therapeutic antibody efficacy by preventing FCGR2B-mediated inhibition while potentially leveraging its ability to cross-link stimulatory checkpoint receptors in certain contexts .

What are the molecular mechanisms by which FCGR2B regulates T cell activation and apoptosis?

FCGR2B has been identified as a regulator of CD8+ T cell function and survival through several mechanisms:

  • Induction in activated T cells: A subset of effector CD8+ T cells expresses FCGR2B following activation and multiple rounds of division

  • Ligand interaction: Fgl2 (fibrinogen-like protein 2) can physically ligate FCGR2B on CD8+ T cells, as demonstrated by:

    • Binding studies showing Fgl2 binding to wild-type but not Fcgr2b−/− CD8+ T cells

    • Blocking experiments using the 2.4G2 antibody to prevent Fgl2-FCGR2B interaction

  • Apoptosis induction: Fgl2 ligation of FCGR2B induces apoptosis in FCGR2B-expressing CD8+ T cells, evidenced by:

    • Increased frequency of active caspase 3/7+ 7-AAD+ cells among wild-type CD8+ T cells treated with Fgl2

    • Absence of this effect in Fcgr2b−/− CD8+ T cells

  • Signaling cascades: FCGR2B likely employs ITIM (immunoreceptor tyrosine-based inhibition motif) signaling to:

    • Recruit phosphatases like SHIP-1

    • Counteract activating signals in T cells

    • Initiate pro-apoptotic cascades

These findings suggest that FCGR2B expression on CD8+ T cells represents a novel regulatory mechanism for controlling T cell responses and may be particularly relevant in chronic infection and cancer settings where T cell exhaustion and apoptosis are prominent features .

What emerging technologies are advancing FCGR2B research and therapeutic development?

Several cutting-edge technologies are enhancing FCGR2B research:

  • Single-cell analysis: Characterizing heterogeneity in FCGR2B expression and function across immune cell populations and cancer cells

  • CRISPR-Cas9 gene editing: Creating precise knockout and knock-in models to study FCGR2B function and regulation in various cell types

  • High-throughput screening: Identifying novel compounds that can modulate FCGR2B activity or expression

  • Structural biology approaches: Obtaining detailed crystal structures of FCGR2B in complex with various ligands to facilitate structure-based drug design

  • Improved recombinant cell lines: Developing more sophisticated cellular models with controlled expression levels and reporter systems for FCGR2B activity

  • Bioinformatic integration: Combining multiple -omics approaches (transcriptomics, proteomics, metabolomics) to understand FCGR2B regulatory networks, particularly in cancer contexts

These technological advances promise to accelerate both basic understanding of FCGR2B biology and the development of therapeutic approaches targeting this receptor.

How might targeting FCGR2B in combination with other immunotherapies improve cancer treatment outcomes?

Combining FCGR2B-targeted approaches with other immunotherapies offers several promising strategies:

  • Enhancing checkpoint inhibitor efficacy: FCGR2B inhibition could potentiate anti-PD-1/PD-L1 or anti-CTLA-4 therapies by:

    • Preventing antibody clearance, thus maintaining therapeutic concentrations

    • Enhancing effector immune cell activation by removing inhibitory signals

  • CAR-T cell optimization: Engineering CAR-T cells resistant to FCGR2B-mediated inhibition or developing approaches to block FCGR2B signaling in adoptively transferred T cells

  • Targeting the tumor microenvironment: Modulating FCGR2B could reshape the immunosuppressive tumor microenvironment, given its positive correlation with immune scores and immune checkpoint molecules

  • Biomarker-guided combination therapy: Using FCGR2B expression as a biomarker to identify patients who might benefit from specific combination strategies

  • Dual-targeting antibodies: Developing bispecific antibodies that simultaneously engage tumor antigens and block FCGR2B function

The strong correlation between FCGR2B expression and tumor mutation load also suggests potential synergy with therapies targeting neoantigens, as well as combining FCGR2B modulation with radiation or chemotherapy to enhance immunogenic cell death .

What are common difficulties in studying FCGR2B in cell culture systems and how can they be addressed?

Researchers frequently encounter several challenges when studying FCGR2B:

  • Expression level variation: FCGR2B expression can vary significantly between cell lines and primary cells

    • Solution: Quantify expression levels via flow cytometry before experiments and standardize by cell sorting or inducible expression systems

  • Isoform specificity: Distinguishing between FCGR2B1 and FCGR2B2 functions

    • Solution: Use isoform-specific primers for qPCR and isoform-specific antibodies when available; employ recombinant cell lines expressing single isoforms

  • Cross-reactivity with other FcγRs: Difficulty in isolating FCGR2B-specific effects

    • Solution: Use Fcgr2b−/− cells as controls; employ specific blocking antibodies; design experiments comparing responses in cells expressing only FCGR2B versus other FcγRs

  • Mycoplasma contamination: Can significantly affect immune receptor signaling

    • Solution: Regular screening of cell cultures; use mycoplasma-free validated cell lines

  • Media requirements: Specialized media needed for FCGR2B-expressing recombinant cell lines

    • Solution: Follow recommended media formulations (e.g., Thaw Medium 3, Growth Medium 3D for CHO-K1 recombinant lines)

Addressing these challenges through careful experimental design and appropriate controls ensures more reliable and reproducible results in FCGR2B research.

How can researchers accurately assess FCGR2B-mediated effects in complex in vivo systems?

Evaluating FCGR2B function in vivo requires sophisticated approaches:

  • Genetic models: Utilize:

    • Global Fcgr2b knockout models

    • Cell type-specific conditional knockouts (using Cre-loxP systems)

    • Humanized mouse models expressing human FCGR2B

  • Lineage tracing: Track FCGR2B expression changes during immune responses using:

    • Reporter mice with fluorescent proteins under FCGR2B promoter control

    • Fate-mapping approaches to follow FCGR2B-expressing cells over time

  • Pharmacological approaches:

    • Use specific FCGR2B-blocking antibodies with minimal Fc-mediated effects

    • Apply Fgl2 or other specific ligands to modulate FCGR2B signaling

    • Employ siRNA/shRNA delivery systems for targeted in vivo knockdown

  • Analytical methods:

    • Multi-parameter flow cytometry to correlate FCGR2B expression with functional readouts

    • Mass cytometry (CyTOF) for comprehensive immune profiling

    • Spatial transcriptomics to map FCGR2B expression in tissues

  • Data integration approaches:

    • Combine transcriptomics data with survival outcomes similar to approaches used in glioma studies

    • Correlate immune scores with FCGR2B expression and clinical parameters

These multifaceted approaches allow researchers to dissect FCGR2B-specific effects in complex biological systems while accounting for the heterogeneity of immune responses in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.