Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-c (FCGR2C)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Variants

The FCGR2C gene exhibits notable polymorphism, with significant implications for protein expression and function. A critical single nucleotide polymorphism (SNP) in exon 3 of FCGR2C results in either expression of the activating FcγRIIc (FCGR2C-open reading frame [ORF]) or its absence due to a stop codon (FCGR2C-Stop) . This polymorphism is functionally important as it determines whether an individual expresses the activating receptor.

Additional complexity arises from "nonclassical" FCGR2C-ORF alleles, in which FcγRIIc expression is unexpectedly absent despite the presence of an open reading frame. This phenomenon has been traced to novel splice site mutations near exon 7 that introduce another stop codon . Furthermore, certain individuals with FCGR2C-Stop alleles have been found to express FcγRIIb on NK cells, which normally do not express this inhibitory receptor. This expression pattern has been linked to a deletion of FCGR2C-FCGR3B that extends into the promoter region of the adjacent FCGR2B gene, possibly removing a negative regulatory element in the FCGR2B promoter in NK cells .

Copy Number Variation

Unlike some related genes (FCGR2A and FCGR2B), which do not show copy number variation (CNV), the FCGR2C gene exhibits significant CNV in human populations. In a study of 100 healthy white controls, the distribution of FCGR2C gene copy numbers was found to be as follows :

FCGR2C CopiesControls (%)ITP Patients (%)Adult ITP (%)Children ITP (%)
17 (7)6 (5.2)0 (0)6 (8.3)
282 (82)103 (88.8)41 (93.1)62 (86.1)
311 (11)7 (6.0)3 (6.8)4 (5.6)

This variation in gene copy number is directly linked to similar variation in the FCGR3B gene, demonstrating the complex genetic architecture of this region .

Expression Pattern and Cellular Distribution

The expression pattern of FCGR2C shows cell-type specificity that contributes to its functional significance in the immune system. mRNA expression studies have revealed that transcripts for FcγRIIc are found in neutrophils, monocytes, and notably, NK cells . This distribution is significant, as NK cells express FcγRIIc as their only FcγRII isoform.

The expression of FcγRIIc protein on NK cells correlates directly with the presence of an FCGR2C-ORF allele. Individuals with the FCGR2C ORF/stop genotype express FcγRII on their NK cells, whereas those with the FCGR2C stop/stop genotype show a complete absence of FcγRII on NK cells . This pattern confirms that the expression of functional FcγRIIc depends on the genetic status of the FCGR2C gene.

Functional Significance in Immunity

FCGR2C plays a critical role in the immune system by serving as an activating IgG receptor that mediates antibody-dependent cellular cytotoxicity (ADCC) by immune cells. This function is particularly important for NK cell-mediated cytotoxicity against antibody-coated target cells .

The balance between activating and inhibitory signals from different FcγR subtypes is crucial for maintaining homeostasis in immune complex-driven inflammatory responses . FCGR2C contributes to this balance as an activating receptor, with its expression potentially influencing the threshold for immune activation or inhibition.

In individuals where FcγRIIb is expressed on NK cells (due to the genetic variations described earlier), this inhibitory receptor effectively suppresses killing mediated by FcγRIIIa (CD16a) in antibody-dependent cytotoxicity assays . This finding highlights the functional importance of the relative expression of activating versus inhibitory Fc receptors on immune cells.

Association with Autoimmune Disorders

FCGR2C has been strongly linked to autoimmune conditions, particularly idiopathic thrombocytopenic purpura (ITP). The activating FCGR2C-ORF genotype is significantly overrepresented in ITP patients compared to healthy controls, with an odds ratio of 2.4 (1.3-4.5, p < 0.009) . This association suggests that the expression of functional FCGR2C may predispose individuals to ITP by altering the balance of activating and inhibitory FcγR on immune cells.

In one study, the FCGR2C-ORF allele was found in 18% of healthy individuals but was present in 34.4% of ITP patients, representing a significant enrichment . Researchers have proposed that this activating genotype contributes to unbalanced immunity, potentially leading to autoimmune manifestations.

Role in Sepsis Prognosis

More recent research has identified FCGR2C as an emerging immune gene for predicting sepsis outcomes. Studies suggest that FCGR2C could serve as an immune biomarker associated with prognosis in septic patients . This finding points to a potential new direction for immunotherapy approaches aimed at reducing sepsis mortality.

Correlation analyses between FCGR2C and clinical indicators in septic patients have shown associations with severity indices such as SOFA scores, APACHE II scores, and inflammatory markers like interleukins . These correlations reinforce the role of FCGR2C in modulating inflammatory responses during severe infections.

Recombinant FCGR2C: Production and Applications

Recombinant Human FCGR2C is produced through various expression systems, with E. coli being commonly used for commercial production. The protein is typically fused to tags such as GST to facilitate purification and downstream applications . The recombinant form of FCGR2C enables researchers to study its structural and functional properties in controlled laboratory settings.

Applications of recombinant FCGR2C include:

  1. Functional studies of receptor-ligand interactions

  2. Development of diagnostic tools for autoimmune conditions

  3. Screening of therapeutic antibodies for Fc receptor binding profiles

  4. Structural studies to inform drug design targeting FcγR interactions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag if requested.
Synonyms
FCGR2C; CD32; FCG2; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-c; IgG Fc receptor II-c; CDw32; Fc-gamma RII-c; Fc-gamma-RIIc; FcRII-c; CD antigen CD32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-323
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Uniprot No.

Target Background

Function
FcγRIIc is a low-affinity receptor for the Fc region of immunoglobulin G (IgG) immune complexes. It plays a crucial role in various effector and regulatory immune functions, including phagocytosis of immune complexes and modulation of antibody production by B cells.
Gene References Into Functions

Functional Significance of FCGR2C: A Review of Key Research Findings

  1. Association of higher-affinity FCGR2A, FCGR3A, and FCGR2C genotypes with increased tumor shrinkage and prolonged survival following high-dose interleukin-2 (HD-IL2) treatment. This represents the first study demonstrating a correlation between FCGR genotypes and HD-IL2 treatment outcomes. PMID: 27742794
  2. Strong association of the nonclassical open reading frame in the FCGR2C gene (FCGR2C.nc-ORF) with reduced alloimmunization risk (odds ratio [OR] 0.26, 95% confidence interval [CI] 0.11-0.64). PMID: 28899854
  3. Correlation between gene copy number variation (CNV) of PKLR, FCGR2A, FCGR2C, and FCGR3 genes and malaria severity, highlighting the role of CNV in host responses to malaria. PMID: 28605553
  4. Potential contribution of FCGR2A and FCGR2C polymorphisms to immunocomplexemia in sarcoidosis. PMID: 26801149
  5. Evidence of ethnic variations at the FCGR gene locus, particularly for FCGR2C, a gene with increasing clinical significance. PMID: 26673965
  6. Strong association between FCGR2C SNPs linked to vaccine efficacy in RV144 and the expression of FCGR2A/C, with one SNP also associated with Fc receptor-like A (FCRLA) expression. PMID: 27015273
  7. Presence of an FCGR2A/2C chimeric gene associated with decreased expression. PMID: 26133275
  8. Lower frequency of copy number variations in FCGR3A compared to FCGR3B and FCGR2C. PMID: 26032265
  9. Identification of an FCGR2C tag SNP (rs114945036) associated with vaccine efficacy against HIV-1 subtype CRF01_AE. PMID: 25105367
  10. Discovery of allele-dependent expression of the activating FcγRIIc on B cells, highlighting the functional significance of this receptor. PMID: 24353158
  11. Influence of FcγR2C and FcγR3B gene copy number on IVIG treatment response and predisposition to Kawasaki disease. PMID: 23778324
  12. Genomic pathology of SLE-associated copy-number variation at the FCGR2C/FCGR3B/FCGR2B locus. PMID: 23261299
  13. Identification of additional variations in FcγRIIb/c expression on leukocytes, expanding our understanding of FcγR expression’s role in immunity and inflammation. PMID: 22198951
  14. Lack of association between FcγRIIb/c gene polymorphisms and breast cancer. PMID: 20978933
  15. Predisposition of activating FCGR2C-ORF genotype to idiopathic thrombocytopenic purpura by altering the balance of activating and inhibitory FcγR on immune cells. PMID: 17827395
  16. Copy number variation observed only in FCGR3A, FCGR2C, and FCGR3B, in contrast to FCGR2A and FCGR2B. PMID: 19309690
Database Links

HGNC: 15626

OMIM: 612169

KEGG: hsa:9103

UniGene: Hs.654395

Subcellular Location
[Isoform IIC4]: Cytoplasm.; [Isoform IIC3]: Cell membrane; Single-pass type I membrane protein.; [Isoform IIC2]: Cell membrane; Single-pass type I membrane protein.; [Isoform IIC1]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.