Recombinant Human Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
LDLRAD1; Low-density lipoprotein receptor class A domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LDLRAD1
Target Protein Sequence
MNKVFPQGENGYTAAESKAHPGGEAGGGHLCCSRRGACLSASLLLLLATVAALIALVTIL GLPSCTPGAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSL PHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPPCGPGWWRCPSTFFKYCDC IPRHLCRDHVQHCSDWSDEYACPGP
Uniprot No.

Target Background

Database Links

HGNC: 32069

KEGG: hsa:388633

STRING: 9606.ENSP00000360411

UniGene: Hs.439583

Protein Families
LDLR family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of LDLRAD1 and how does it compare to other LDLR family members?

LDLRAD1 is a 205 amino acid protein belonging to the LDLR family, characterized by LDL receptor class A domains . When expressed recombinantly, researchers typically work with fragments in specific ranges (e.g., 97-198 aa) rather than the full-length protein .

The protein shares structural homology with other LDLR family members but differs in key aspects:

FeatureLDLRAD1LDLRLRP1
Size205 aa860 aa4544 aa (α-chain: 515 kDa, β-chain: 85 kDa)
DomainsLDL receptor class A domainsLigand-binding domains, EGF precursor homology domains, O-linked sugar domains, cytoplasmic tail31 complement-like cysteine-rich ligand binding repeats, 22 EGF-like repeats, 8 YWTD β-propellers
ConservationModerate (74% mouse/rat sequence identity in aa 68-135) HighHigh

To accurately determine LDLRAD1's functional domains, employ multiple sequence alignment with other LDLR family members, followed by structural prediction software like Phyre2 or I-TASSER to model three-dimensional configurations.

What expression systems are most effective for producing functional recombinant LDLRAD1?

Based on available research protocols, several expression systems can be employed for LDLRAD1 production:

  • Bacterial expression (E. coli): Most commonly used for producing LDLRAD1 fragments (aa 97-198) with >85% purity suitable for SDS-PAGE . This system offers high yield but may lack post-translational modifications.

  • Mammalian expression: For studies requiring physiologically relevant modifications, HEK293 systems similar to those used for LDLR family proteins are recommended . The HEK293T-based systems developed for LDLR expression can be adapted for LDLRAD1, particularly when studying receptor functions that depend on glycosylation patterns.

  • GnTI− HEK293-EBNA1-S cells: For applications requiring homogeneous glycosylation patterns (such as those used in structural studies of LRP1), this system provides shorter, more homogenous N-linked glycan chains .

Methodologically, designing expression constructs with appropriate affinity tags (His6, GST) facilitates downstream purification. For LDLRAD1, include a TEV or PreScission protease cleavage site between the tag and protein to enable tag removal without disrupting protein structure.

How should researchers validate recombinant LDLRAD1 identity and functionality?

A comprehensive validation protocol should include:

Structural Validation:

  • SDS-PAGE to confirm protein size (~205 kDa for full-length or appropriate size for fragments)

  • Western blot using specific antibodies (e.g., those targeting LDLRAD1's LDL receptor class A domains)

  • Mass spectrometry for precise molecular weight determination and sequence verification

Functional Validation:

  • Binding assays with known ligands or binding partners

  • Surface Plasmon Resonance (SPR) to determine binding kinetics, similar to methodologies used for LRP1-RAP binding studies

  • Cell-based functional assays measuring cellular responses (adapting methods used for LDLR functional studies)

In particular, researchers should implement controls similar to those used in LDLR variant studies, where both wild-type and known non-functional variants serve as references for comparative analysis .

What methodologies are most effective for studying LDLRAD1's role in lipoprotein metabolism?

Given LDLRAD1's position in regulatory networks governing lipid levels , several methodological approaches can effectively explore its function:

Cell-Based Systems:

  • Knockout/Knockdown Systems: Establish CRISPR/Cas9-mediated LDLRAD1-deficient cell lines similar to the LDLR-defective HEK293T cell line (HEK293T-ldlrG1) . Alternatively, employ siRNA-mediated knockdown using validated sequences .

  • Lipid Uptake Assays: Adapt fluorescent LDL uptake assays from LDLR studies to measure LDLRAD1's impact on lipoprotein internalization . This single-cell, kinetic approach allows real-time measurement of lipid trafficking.

  • Reporter Systems: Develop luciferase-based reporter systems to study LDLRAD1 promoter regulation under various metabolic conditions, similar to the LDLR promoter-luciferase knock-in system .

Analytical Techniques:

  • Lipidomics to quantify changes in cellular lipid composition

  • RT-qPCR to measure expression levels of LDLRAD1 and related metabolic genes

  • Confocal microscopy to track protein localization and co-localization with endoplasmic reticulum markers (e.g., calregulin) or cell membrane markers

When designing these experiments, consider including positive controls such as LDLR variants with known functional impacts (e.g., p.(Trp87*), a variant that is not expressed, or p.(Cys681*), a class 2 mutation) .

How can researchers effectively analyze LDLRAD1 genetic variants and their functional consequences?

To comprehensively analyze LDLRAD1 variants (such as rs145889899 implicated in breast cancer ), implement a multi-tiered approach:

1. Variant Classification Framework:
Establish a classification system similar to that used for LDLR variants:

  • Class 1: Null alleles (no protein produced)

  • Class 2: Transport-defective alleles (protein retained in ER)

  • Class 3: Binding-defective alleles (impaired ligand binding)

  • Class 4: Internalization-defective alleles

  • Class 5: Recycling-defective alleles

2. Experimental Validation Protocol:

  • Expression analysis: Quantify variant expression levels via Western blot, normalizing to housekeeping proteins (e.g., GAPDH)

  • Localization studies: Use confocal microscopy with subcellular markers to determine whether variants reach the cell surface or are retained intracellularly

  • Functional assays: Measure ligand binding and internalization capacity of each variant

3. Data Integration Framework:

Analysis LevelMethodologyOutcome Measure
SequenceIn silico prediction toolsPathogenicity scores
ExpressionWestern blot, qPCRRelative expression levels
LocalizationConfocal microscopySubcellular distribution
FunctionBinding/uptake assays% activity compared to WT

This multi-parameter assessment allows for comprehensive variant characterization and avoids misclassification based on single assays.

What are optimal experimental designs for investigating LDLRAD1's potential interactions with insulin signaling pathways?

Drawing from research on the related LRP1 protein, which connects lipoprotein metabolism and insulin signaling , researchers should consider the following experimental design:

1. Protein-Protein Interaction Studies:

  • Co-immunoprecipitation of LDLRAD1 with insulin receptor and related signaling proteins

  • Proximity ligation assays to visualize interactions in situ

  • FRET/BRET assays to detect dynamic interactions in living cells

2. Signaling Pathway Analysis:

  • Phosphorylation assays measuring Akt, ERK1/2, and other insulin signaling intermediates

  • Time-course experiments to determine temporal relationships between insulin stimulation and LDLRAD1 translocation/activation

  • Inhibitor studies using specific pathway blockers (PI3K, MAPK inhibitors)

3. Translocation Assays:
Adapt methodologies from studies showing insulin-stimulated LRP1 translocation to cell surfaces :

  • Surface biotinylation to quantify membrane-associated LDLRAD1 before and after insulin stimulation

  • TIRF microscopy to visualize real-time translocation events

  • Flow cytometry to measure surface expression levels under various conditions

4. Optimized Experimental Design:
Based on the principles of optimal experimental design described in , implement iterative experimental planning:

  • Begin with factorial design experiments to identify key parameters

  • Use numerical methods to design experiments that minimize uncertainty in parameter estimates

  • Implement time-course and dose-response studies with optimized sampling points

This methodological approach ensures efficient use of resources while maximizing information gain about LDLRAD1's potential role in insulin signaling.

What techniques are most appropriate for studying potential proteolytic processing of LDLRAD1?

Research on LDLR has revealed important proteolytic processing events, such as cleavage by bone morphogenetic protein 1 (BMP1) . To investigate whether LDLRAD1 undergoes similar processing:

1. In Vitro Proteolysis Assays:

  • Incubate purified recombinant LDLRAD1 with candidate proteases (e.g., BMP1, metalloproteases)

  • Analyze cleavage products using SDS-PAGE, Western blotting, and N-terminal sequencing

  • Use site-directed mutagenesis to identify critical residues in potential cleavage sites

2. Cellular Processing Analysis:

  • Pulse-chase experiments to track LDLRAD1 maturation and processing

  • Protease inhibitor studies to identify protease classes involved in processing

  • Domain-specific antibodies to detect distinct fragments

3. Sequence-Based Prediction and Validation:

  • Use MEROPS peptidase database to identify potential cleavage sites based on sequence analysis

  • Generate cleavage site mutants to test functional consequences

  • Compare processing patterns across species to identify conserved mechanisms

These approaches should be complemented with mass spectrometry analysis of both recombinant protein and endogenously expressed LDLRAD1 to identify processing events occurring under physiological conditions.

How can researchers investigate LDLRAD1's potential role in disease pathogenesis, particularly in metabolic and cardiovascular disorders?

Given the association of LDLR family members with metabolic syndrome, cardiovascular disease, and cancer , a comprehensive disease association study for LDLRAD1 should include:

1. Clinical Correlation Studies:

  • Analyze LDLRAD1 expression in disease-relevant tissues using immunohistochemistry and qPCR

  • Perform case-control studies examining LDLRAD1 genetic variants in patient cohorts

  • Correlate LDLRAD1 levels with clinical parameters and disease progression markers

2. Animal Models:

  • Generate tissue-specific LDLRAD1 knockout mice, focusing on liver, adipose tissue, and vascular cells

  • Challenge these models with high-fat diets or other metabolic stressors

  • Assess phenotypes related to lipid metabolism, glucose homeostasis, and vascular function

3. Transcriptomic Analysis:
Similar to studies on lipid accumulation in cardiomyocytes , perform:

  • RNA-seq analysis comparing control and disease states

  • Pathway enrichment analysis to identify associated biological processes

  • Integration with existing metabolic syndrome datasets to identify gene interaction networks

4. Mechanistic Studies in Disease Models:

  • Investigate LDLRAD1's impact on cellular lipid accumulation

  • Examine effects on insulin signaling and glucose metabolism

  • Assess influence on inflammatory pathways and oxidative stress

This multi-faceted approach enables identification of both correlative and causative relationships between LDLRAD1 and disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.