Recombinant Human Lysophospholipid acyltransferase LPCAT4 (LPCAT4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LPCAT4; AGPAT7; AYTL3; LPEAT2; Lysophospholipid acyltransferase LPCAT4; 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-alkenylglycerophosphoethanolamine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acyltransferase-like 3; Lysophosphatidylcholine acyltransferase 4; Lysophosphatidylethanolamine acyltransferase 2; Plasmalogen synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LPCAT4
Target Protein Sequence
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEF ARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYG KLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
Uniprot No.

Target Background

Function
Recombinant Human Lysophospholipid acyltransferase LPCAT4 exhibits acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates. Specifically, it catalyzes the conversion of lysophosphatidylethanolamine to phosphatidylethanolamine, lysophosphatidylcholine to phosphatidycholine, 1-alkenyl-lysophatidylethanolamine to 1-alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol to phosphatidylglycerol, and alkyl-lysophosphatidylcholine to alkyl-phosphatidylcholine. LPCAT4 does not display lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol, or lysophosphatidic acid acyltransferase activity. It exhibits a preference for long-chain acyl-CoAs (C16, C18) as acyl donors.
Gene References Into Functions
  1. LPCAT4 overexpression is implicated in the dysregulation of PC(16:0/16:1) in colorectal cancer. PMID: 23815430
  2. A report details the cloning and characterization of the human AGPAT7 (1-acyl-sn-glycerol-3-phosphate acyltransferase 7) gene, a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase, mapped to human chromosome 15q14. PMID: 16243729
  3. LPEAT2 is identified as a crucial enzyme in the biosynthesis of ethanolamine-containing phospholipids, particularly in the brain. PMID: 18458083
Database Links

HGNC: 30059

OMIM: 612039

KEGG: hsa:254531

STRING: 9606.ENSP00000317300

UniGene: Hs.352614

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with predominant level in brain.

Q&A

What is LPCAT4 and what is its primary enzymatic function?

LPCAT4 (Lysophosphatidylcholine acyltransferase 4) belongs to the LPCAT family consisting of four isoforms (LPCAT1-4) in humans. It functions primarily as an enzyme that catalyzes the conversion of lysophospholipids to phospholipids in the Lands' cycle of membrane phospholipid remodeling . Specifically, LPCAT4 possesses both LPCAT (lysophosphatidylcholine acyltransferase) and LPEAT (lysophosphatidylethanolamine acyltransferase) activities, converting lysophosphatidylcholine (LPC) to phosphatidylcholine (PC) and lysophosphatidylethanolamine (LPE) to phosphatidylethanolamine (PE) .

Unlike other members of the LPCAT family, LPCAT4 shows distinct substrate preferences, demonstrating a clear preference for oleoyl-CoA (18:1) as an acyl donor . This specificity contributes to the diversity and asymmetry of glycerophospholipids in cellular membranes.

How does LPCAT4 expression vary across different tissues and cellular contexts?

LPCAT4 expression exhibits tissue-specific and context-dependent patterns. In developmental contexts, LPCAT4 mRNA expression is stronger in the hypertrophic zone of cartilage than in the prehypertrophic zone, suggesting its role in chondrocyte differentiation .

In pathological contexts, LPCAT4 mRNA and protein expression levels are significantly elevated in hepatocellular carcinoma (HCC) tissues compared to normal tissues . The Cancer Cell Line Encyclopedia (CCLE) database indicates that LPCAT4 is expressed in a majority of HCC cell lines, making it a relevant research target in cancer biology .

What are the established methods for studying LPCAT4 expression and activity?

Several methodologies have been validated for investigating LPCAT4:

Expression Analysis:

  • Quantitative PCR (qPCR) for mRNA expression analysis

  • Western blotting for protein expression analysis

  • Immunohistochemistry as demonstrated in the Human Protein Atlas (HPA) database

Activity Assays:

  • LPCAT enzymatic activity assays using various fatty acyl-CoAs (18:1-, 18:2-, 20:4-, and 22:6-CoA) as substrates

  • Recombinant protein assays using FLAG-tagged LPCAT4 to assess substrate preferences

Functional Studies:

  • siRNA knockdown approaches to assess LPCAT4's role in cellular processes

  • Cell proliferation assays (MTT assay) following LPCAT4 modulation

  • Colony formation assays to evaluate cell growth potential

These methodological approaches provide complementary insights into LPCAT4's expression patterns, enzymatic activities, and biological functions in various experimental systems.

How can LPCAT4 function be effectively modulated in experimental settings?

LPCAT4 function can be modulated through several experimental approaches:

Genetic Modulation:

  • siRNA-mediated knockdown has been successfully employed to suppress LPCAT4 expression without affecting other LPCAT family members (LPCAT1-3)

  • Stable cell lines with down-regulated LPCAT4 expression have been developed for long-term functional studies

  • Overexpression systems using recombinant LPCAT4 can be utilized to study gain-of-function effects

Validation of Knockdown Efficacy:

  • Verification of specific LPCAT4 suppression without affecting LPCAT1-3 expression is critical

  • Assessment of cell viability post-transfection ensures that observed phenotypes are not due to cytotoxicity

When implementing these approaches, maintaining appropriate controls is essential, including scramble siRNA as a negative control and monitoring cell viability to ensure experimental observations reflect specific LPCAT4 modulation rather than general cellular stress responses .

How does LPCAT4 contribute to cholesterol metabolism?

LPCAT4 plays a significant role in cholesterol biosynthesis, particularly in hepatocellular carcinoma (HCC):

  • LPCAT4 positively regulates cholesterol synthesis in HCC cells, as demonstrated by decreased cholesterol levels following LPCAT4 knockdown

  • The mechanism involves LPCAT4-mediated regulation of ACSL3 (Acyl-CoA Synthetase Long Chain Family Member 3), a cholesterol biosynthesis enzyme:

    • LPCAT4 down-regulation inhibits ACSL3 mRNA and protein expression

    • Overexpression of LPCAT4 increases cholesterol biosynthesis, an effect that is nullified by ACSL3 knockdown

    • Conversely, ACSL3 overexpression can rescue the decreased cholesterol biosynthesis caused by LPCAT4 down-regulation

  • This regulatory pathway is mediated by the WNT/β-catenin/c-JUN signaling cascade, establishing a mechanistic link between LPCAT4 and cellular lipid metabolism

These findings highlight LPCAT4 as a potential metabolic regulator in cancer cells, affecting not only membrane phospholipid composition but also cholesterol homeostasis through ACSL3 regulation.

What is known about LPCAT4's substrate specificity compared to other LPCAT family members?

LPCAT4 demonstrates distinct substrate preferences compared to other LPCAT family members:

LPCAT Family MemberPrimary ActivitiesPreferred Acyl-CoA DonorsAcceptor Lysophospholipids
LPCAT3LPCAT, LPEAT, LPSATPolyunsaturated fatty acyl-CoAs (18:2, 20:4)LPC, LPE, LPS
LPCAT4LPCAT, LPEATOleoyl-CoA (18:1)LPC, LPE
LPEAT1LPEAT, LPSATOleoyl-CoA (18:1)LPE, LPS

LPCAT4 shows a clear preference for oleoyl-CoA (18:1) as an acyl donor, unlike LPCAT3 which utilizes various polyunsaturated fatty acyl-CoAs . While LPCAT4 possesses both LPCAT and LPEAT activities, it does not demonstrate significant LPSAT (lysophosphatidylserine acyltransferase) activity that is observed in LPEAT1 .

These substrate specificities contribute to the diverse fatty acid composition of membrane phospholipids and potentially influence membrane fluidity and function in different cellular contexts.

What role does LPCAT4 play in cancer progression?

LPCAT4 has emerged as a significant factor in cancer biology, particularly in hepatocellular carcinoma (HCC):

Expression in Cancer:

  • LPCAT4 expression is significantly elevated in HCC tissues compared to normal tissues at both mRNA and protein levels

  • The entire LPCAT family (LPCAT1-4) has been implicated in various malignancies, including clear cell renal cell carcinomas, prostate cancer, esophageal squamous cell carcinoma, lung cancer, and colorectal cancer

Functional Impact in Cancer:

  • Down-regulation of LPCAT4 decreases cell growth and colony formation ability in HCC cell lines

  • LPCAT4 influences the expression of genes involved in mitotic nuclear division, DNA metabolic processes, and cell cycle regulation

  • Functional enrichment analysis reveals that LPCAT4-regulated genes are associated with pathways including cell cycle, cellular senescence, and PPAR signaling

Prognostic Significance:

These findings establish LPCAT4 as both a potential biomarker and therapeutic target in cancer, particularly HCC, with implications for prognosis and treatment strategies.

How is LPCAT4 involved in chondrogenic differentiation?

LPCAT4 plays an important role in chondrocyte differentiation and mineralization:

  • LPCAT4 expression increases during chondrogenic differentiation of ATDC5 cells and C3H10T1/2 cells, particularly in the late stages when mineralization occurs

  • In mouse embryos, LPCAT4 mRNA expression is stronger in the hypertrophic zone of cartilage compared to the prehypertrophic zone, suggesting involvement in chondrocyte hypertrophy

  • Functional studies using LPCAT4 knockdown in ATDC5 cells revealed:

    • Decreased expression of chondrogenic markers including Col10, alkaline phosphatase (ALP), aggrecan, and transforming growth factor-β (TGF-β)

    • Reduced Alcian blue staining intensity, indicating decreased proteoglycan content

    • Diminished alkaline phosphatase (ALP) activity, a marker of mineralization

    • Suppressed expression of bone morphogenetic proteins (BMPs), which regulate chondrogenic differentiation

  • These findings suggest that LPCAT4 facilitates the transition of chondrocytes into hypertrophic chondrocytes and/or a mineralized phenotype, rather than affecting the initial attainment of the chondrogenic phenotype

This role in chondrogenic differentiation highlights LPCAT4's importance beyond lipid metabolism, positioning it as a regulator of cellular differentiation programs with potential implications for skeletal development and related disorders.

What are the key experimental challenges in studying LPCAT4 enzymatic activity?

Researchers face several methodological challenges when investigating LPCAT4 enzymatic activity:

Temporal Discrepancies:

  • A notable 10-day delay between increased LPCAT4 gene expression and detectable enzymatic activity has been observed during chondrogenic differentiation

  • This suggests that not all transcribed LPCAT4 is immediately translated into active enzyme, or that post-translational modifications may be required for activity

Assay Sensitivity Issues:

  • Despite clear LPCAT4 knockdown at the mRNA level, changes in enzymatic activity may not be detectable using standard assays

  • This could indicate insufficient assay sensitivity or that the in vitro experimental conditions differ significantly from the cellular environment in vivo

Alternative Functions:

  • LPCAT4 might possess functions beyond its characterized enzymatic activity, such as protein-protein interactions with transcription factors or acting as a scaffold protein

  • These potential alternative functions would require different experimental approaches to identify and characterize

Substrate Availability:

  • In vitro activity assays may not accurately reflect the cellular environment, particularly regarding protein content and substrate availability

  • These experimental limitations necessitate careful interpretation of enzymatic activity data and correlation with biological phenotypes

Researchers should consider these challenges when designing experiments to study LPCAT4 function and interpreting results from enzymatic activity assays.

How might LPCAT4 be targeted for therapeutic purposes in cancer?

Based on current research, several approaches for targeting LPCAT4 in cancer therapy can be considered:

Direct Inhibition Strategies:

  • Development of small molecule inhibitors specific to LPCAT4 enzymatic activity

  • RNA interference approaches (siRNA, shRNA) for selective suppression of LPCAT4 expression

  • CRISPR-Cas9 gene editing for knockout or repression of LPCAT4 in tumors

Targeting Downstream Pathways:

  • Interference with LPCAT4-mediated regulation of ACSL3 to disrupt cholesterol biosynthesis in cancer cells

  • Modulation of the WNT/β-catenin/c-JUN signaling pathway that mediates LPCAT4's effects

Predictive and Companion Diagnostics:

  • Utilization of LPCATs score (including LPCAT4 expression) as a prognostic marker for cancer patients

  • Potential application as a predictor of response to immune checkpoint inhibitor (ICI) therapies

Combination Approaches:

  • Integration of LPCAT4 targeting with standard chemotherapies

  • Combination with metabolic interventions targeting cholesterol biosynthesis

When considering these therapeutic strategies, researchers should account for potential side effects given LPCAT4's role in normal cellular processes, including chondrogenic differentiation and membrane phospholipid remodeling .

What unresolved questions remain about LPCAT4 structure and regulation?

Several critical aspects of LPCAT4 biology remain to be fully elucidated:

Structural Determinants:

  • The three-dimensional structure of LPCAT4 has not been fully characterized

  • Structure-function relationships that determine substrate specificity compared to other LPCAT family members

  • Molecular mechanisms underlying LPCAT4's preference for oleoyl-CoA as an acyl donor

Transcriptional and Post-transcriptional Regulation:

  • Factors controlling tissue-specific and context-dependent expression of LPCAT4

  • Potential epigenetic regulation of LPCAT4 expression in normal development and disease

  • Post-translational modifications that may regulate LPCAT4 activity

  • Explanation for the observed delay between LPCAT4 mRNA expression and enzymatic activity

Protein Interactions:

  • Comprehensive identification of LPCAT4 binding partners beyond the reported interaction with ACSL3

  • Potential protein complexes involving LPCAT4 that may regulate its cellular functions

  • Subcellular localization and trafficking mechanisms that position LPCAT4 in specific membrane compartments

Addressing these knowledge gaps will require integrated approaches combining structural biology, proteomics, and functional genomics to build a more complete understanding of LPCAT4 biology.

How might LPCAT4 research inform our understanding of membrane biology and lipid metabolism?

LPCAT4 research offers several promising avenues for advancing our understanding of membrane biology and lipid metabolism:

Membrane Remodeling Mechanisms:

  • LPCAT4's role in the Lands' cycle provides insights into how cells achieve and maintain specific membrane phospholipid compositions

  • Understanding how LPCAT4's substrate specificity contributes to the diversity and asymmetry of glycerophospholipids in cellular membranes

Integration of Lipid Metabolism with Cellular Signaling:

  • The connection between LPCAT4, ACSL3, and cholesterol biosynthesis reveals cross-talk between phospholipid remodeling and sterol metabolism

  • The relationship between LPCAT4 and WNT/β-catenin/c-JUN signaling demonstrates how lipid metabolism integrates with major cellular signaling pathways

Metabolic Adaptation in Cancer:

  • LPCAT4's upregulation in cancer cells may represent a metabolic adaptation to support rapid proliferation through optimized membrane composition

  • The construction of LPCATs scores provides a new approach to understanding how phospholipid metabolism correlates with cancer aggressiveness and treatment response

Lipid Metabolism in Cellular Differentiation:

  • LPCAT4's role in chondrogenic differentiation suggests that specific phospholipid remodeling events may be required for cellular differentiation programs

  • This represents a potentially underexplored aspect of how lipid metabolism contributes to developmental processes

Future research in these areas could yield fundamental insights into how membrane lipid composition influences cellular function in both normal and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.