Recombinant Human Lysoplasmalogenase-like protein TMEM86A (TMEM86A)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics of TMEM86A

TMEM86A is characterized by its structural and enzymatic features:

  • Structure: Contains 8 transmembrane domains and localizes to the endoplasmic reticulum (ER) .

  • Catalytic Activity: Hydrolyzes lysoplasmalogens (e.g., LPE P-18:0) via conserved aspartate residues (D82, D190), critical for enzymatic function .

  • Substrate Specificity: Preferentially degrades lysoplasmalogen species, distinguishing it from homologs like TMEM86B, which shows broader tissue expression .

Table 1: Comparison of TMEM86A and TMEM86B

FeatureTMEM86ATMEM86B
Tissue ExpressionAdipose tissue, macrophages Liver, intestinal epithelia
Catalytic RoleLysoplasmalogenase in adipocytesGeneral lysoplasmalogenase
RegulationLXR-dependent in macrophages Not well-characterized

Physiological Roles in Adipose Tissue

TMEM86A regulates lipid homeostasis and energy metabolism through:

  • Lysoplasmalogen Degradation: Inhibits lysoplasmalogen accumulation, modulating protein kinase A (PKA) signaling. Loss of TMEM86A increases lysoplasmalogens, suppressing PDE3B (cAMP phosphodiesterase), thereby elevating cAMP and activating HSL/CREB pathways .

  • Mitochondrial Oxidation: Adipocyte-specific TMEM86A knockout (AKO) mice exhibit upregulated mitochondrial proteins (MCAD, UQCRC2, COXIV) and enhanced oxidative phosphorylation, reducing obesity-induced metabolic dysfunction .

Table 2: Metabolic Effects of TMEM86A AKO in Mice

ParameterTMEM86A AKO vs. WTSource
Lysoplasmalogen Levels↑ LPE P-18:0 (2–4×)
Energy Expenditure↑ VO₂, VCO₂, lean mass
Thermogenic GenesUcp1, Ppargc1a
HFD Resistance↓ Body fat, improved insulin sensitivity

Pathological Implications and Therapeutic Potential

  • Obesity and Insulin Resistance: TMEM86A expression is upregulated in obese individuals with insulin resistance, suggesting its role in metabolic dysregulation .

  • Atherosclerosis: TMEM86A is highly expressed in lipid-associated macrophages in atherosclerotic plaques, correlating with LXR-regulated genes .

Table 3: Clinical Correlations of TMEM86A

ConditionTMEM86A Expression/ActivitySource
Obesity↑ In subcutaneous WAT
Atherosclerosis↑ In TREM2+ macrophages

Research Applications of Recombinant TMEM86A

The recombinant protein is utilized in:

  • Enzymatic Assays: Demonstrates lysoplasmalogenase activity in vitro, validated via LC-MS and mutagenesis (e.g., D82A/D190A mutants reduce activity) .

  • LXR Signaling Studies: Overexpression in macrophages reduces lysoplasmalogen levels, linking sterol-regulated TMEM86A to membrane remodeling .

Table 4: Applications of Recombinant TMEM86A

ApplicationMethodologyOutcomeSource
Enzyme ActivityLC-MS, HEK293T overexpression↑ LPE P-18:0 degradation
LXR RegulationBMDM transduction, lipidomics↓ Lysoplasmalogens
Therapeutic ScreeningMetabolic assays in AKO miceProtection against HFD

Regulatory Mechanisms

  • LXR Transcriptional Control: TMEM86A is a direct LXR target in macrophages, linking cholesterol metabolism to lysoplasmalogen homeostasis .

  • Evolutionary Conservation: Catalytic residues (D82, D190) are conserved across bacterial and mammalian YhhN homologs, underscoring ancestral enzymatic function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM86A; Lysoplasmalogenase-like protein TMEM86A; Transmembrane protein 86A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM86A
Target Protein Sequence
MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLG FLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRT GLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAG SGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVESREPVEHYRLTKAN
Uniprot No.

Target Background

Database Links

HGNC: 26890

KEGG: hsa:144110

STRING: 9606.ENSP00000280734

UniGene: Hs.502100

Protein Families
TMEM86 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM86A and what is its primary function?

TMEM86A is a lysoplasmalogenase-like protein that catalyzes the degradation of lysoplasmalogens, which are a subclass of plasmalogens characterized by an ether linkage at the sn-1 position of the glycerol backbone. The primary function of TMEM86A is to regulate plasmalogen metabolism in adipocytes. Studies have confirmed TMEM86A as a bona fide lysoplasmalogenase through comprehensive global phospholipid profiling and direct enzymatic assays in both gain- and loss-of-function analyses . This enzyme plays a crucial role in lipid remodeling within adipose tissue, and its activity has significant implications for metabolic health, particularly in the context of obesity and insulin resistance .

Where is TMEM86A primarily expressed?

TMEM86A is predominantly expressed in adipocytes. Fractionation studies of adipose tissue using a combination of flotation (for adipocytes) and magnetic bead separation (for F4/80+ and PDGFRα+ cells) have demonstrated that Tmem86a mRNA is heavily enriched in adipocytes in both inguinal white adipose tissue (iWAT) and gonadal white adipose tissue (gWAT) . This adipocyte-specific expression pattern is important for researchers to consider when designing tissue-specific experiments to study TMEM86A function. The protein shows significant expression levels in various adipose depots, including brown adipose tissue (BAT), suggesting its importance across different types of adipocytes .

What is the subcellular localization of TMEM86A?

TMEM86A is predominantly localized to the endoplasmic reticulum (ER). This has been demonstrated through colocalization experiments using green fluorescent protein (GFP)-tagged TMEM86A and ER Tracker staining in C3H10T1/2 cells both before and after differentiation . The ER localization is consistent with its function in lipid metabolism, as the ER is a major site for phospholipid synthesis and remodeling. This subcellular localization information is critical for researchers designing experiments to isolate or visualize TMEM86A in cellular contexts.

What is the predicted structure of TMEM86A?

While the crystal structure of TMEM86A has not been experimentally determined, high-confidence AlphaFold computational modeling predicts a protein with 8 transmembrane regions . This structural prediction aligns with its function as a membrane-bound enzyme involved in lipid metabolism. The AlphaFold model has revealed potential catalytic histidine and aspartate residues juxtaposed within the predicted transmembrane region, providing insights into the enzyme's mechanism of action . Researchers should note that these computational predictions serve as a useful starting point for structure-function studies but should be validated experimentally.

Which amino acid residues are critical for TMEM86A catalytic activity?

Evolutionary analysis of the YhhN family proteins has identified several absolutely conserved residues between bacterial and mammalian YhhN lysoplasmalogenases. Among these, D82 and D190 have been experimentally confirmed as critical for TMEM86A's catalytic activity . Mutation studies have demonstrated that D82A or D190A substitutions significantly reduce the lysoplasmalogenase activity of TMEM86A in HEK293T cells . These findings provide important information for researchers designing mutations to study structure-function relationships or developing specific inhibitors of TMEM86A.

How does TMEM86A expression change in obesity and metabolic disease?

TMEM86A expression is significantly upregulated in adipose tissue during metabolic stress conditions. Specifically, high-fat diet (HFD) feeding increases TMEM86A protein levels in white adipose tissue (WAT) of mice compared to normal chow diet (NCD) . This upregulation appears to be specific to TMEM86A, as TMEM86B expression does not change significantly with HFD feeding. Furthermore, analysis of publicly available transcriptome data (GEO: GSE94753) indicates that TMEM86A expression is upregulated in abdominal subcutaneous WAT from female patients with obesity manifesting insulin resistance compared to individuals without obesity . These findings suggest that TMEM86A upregulation may contribute to adipose tissue dysfunction in obesity.

What are the metabolic consequences of adipocyte-specific TMEM86A knockout?

Adipocyte-specific TMEM86A knockout (TMEM86A AKO) mice exhibit several beneficial metabolic phenotypes, particularly when challenged with a high-fat diet. These include:

  • Increased levels of lysoplasmalogens and plasmalogens in adipose tissues

  • Enhanced mitochondrial oxidative metabolism

  • Upregulated expression of thermogenic genes

  • Increased energy expenditure

  • Lower body weight and reduced percentage of body fat

  • Improved thermal regulation under cold exposure

TMEM86A AKO mice show increased levels of mitochondrial proteins involved in oxidative phosphorylation and thermogenesis, including medium-chain acyl-CoA dehydrogenase (MCAD), ATP synthase complex 5 (ATP5A), and uncoupling protein 1 (UCP1) in both brown and white adipose tissues . These mice also exhibit higher energy expenditure without changes in food intake or physical activity, suggesting a direct effect on metabolic efficiency .

How can researchers effectively measure TMEM86A enzymatic activity?

To measure TMEM86A lysoplasmalogenase activity, researchers can employ several complementary approaches:

  • Direct enzymatic assays: Challenge cells expressing TMEM86A (either endogenous or overexpressed) with specific lysoplasmalogen substrates (e.g., LPE P-18:0) and measure substrate depletion over time using liquid chromatography-mass spectrometry (LC-MS) analysis. The activity can be calculated by subtracting residual lysoplasmalogen levels from the initial concentrations in conditioned media .

  • Comprehensive phospholipid profiling: This approach involves untargeted lipidomics to detect changes in multiple phospholipid species, including lysoplasmalogens and plasmalogens, in response to TMEM86A manipulation. Principal component analysis (PCA) can be used to visualize differences in lipid profiles between experimental groups .

  • Mutational analysis: Compare the enzymatic activity of wild-type TMEM86A with mutant versions (e.g., D82A, D190A) to identify critical catalytic residues and understand structure-function relationships .

What are the challenges in analyzing lysoplasmalogen levels in adipose tissue?

Detection of lysoplasmalogens in adipose tissue samples presents several technical challenges:

  • Ion suppression: The abundant neutral lipids in adipose tissue can lead to ion suppression of phospholipids during mass spectrometry analysis, making it difficult to accurately quantify the less abundant lysoplasmalogen species .

  • Sample preparation complexity: Proper extraction and separation techniques are crucial to effectively isolate lysoplasmalogens from the complex lipid matrix of adipose tissue.

  • Standards availability: Limited availability of pure lysoplasmalogen standards can complicate absolute quantification.

Researchers can address these challenges by employing specialized lipid extraction protocols, using internal standards for normalization, and optimizing mass spectrometry parameters for detection of low-abundance lipid species .

How can researchers generate and validate TMEM86A knockout models?

For studying TMEM86A function in vivo, researchers have successfully developed adipocyte-specific TMEM86A knockout (TMEM86A AKO) models by crossing Tmem86a flox/flox (TMEM86A fl/fl) mice with adipoq-Cre mice . The validation of TMEM86A knockout should include:

  • Protein expression analysis: Western blot analysis of target tissues (BAT, iWAT, gWAT) to confirm the absence of TMEM86A protein.

  • Lipid profiling: Untargeted lipidomics analysis to verify the expected accumulation of lysoplasmalogen substrates.

  • Functional validation: Assessment of metabolic parameters that are known to be affected by TMEM86A, such as energy expenditure, body composition, and cold tolerance.

This methodological approach ensures that phenotypic changes can be confidently attributed to the loss of TMEM86A function .

How does lysoplasmalogen supplementation affect metabolism in relation to TMEM86A?

Lysoplasmalogen supplementation, particularly with LPE P-18:0 (the substrate degraded by TMEM86A), has shown promising effects in preventing metabolic dysfunction induced by high-fat diet. Treatment with lysoplasmalogen produces effects similar to those observed in TMEM86A AKO mice, including protection against HFD-induced metabolic dysfunction . This suggests that the beneficial effects of TMEM86A inhibition are mediated through the accumulation of lysoplasmalogens, which appear to act as signaling molecules that promote metabolic health.

Researchers investigating lysoplasmalogen supplementation should consider:

  • The specific lysoplasmalogen species (LPE P-18:0 has shown efficacy)

  • Appropriate dosing regimens

  • Delivery methods to ensure bioavailability

  • Mechanisms of action, particularly effects on PKA signaling pathways

What signaling pathways does TMEM86A affect in adipocytes?

TMEM86A influences several key signaling pathways in adipocytes:

  • PKA signaling: Loss of TMEM86A potentiates protein kinase A (PKA) signaling by inhibiting phosphodiesterase 3B (PDE3B), the major enzyme that degrades cAMP in adipocytes .

  • Mitochondrial oxidative metabolism: TMEM86A AKO increases levels of mitochondrial proteins involved in oxidative phosphorylation and thermogenesis .

  • Thermogenic gene expression: TMEM86A AKO upregulates the expression of thermogenic genes including Ppargc1a, Ucp1, Cox8b, and Dio2 .

These findings suggest that TMEM86A acts as a negative regulator of catabolic signaling in adipocytes, and its inhibition promotes energy expenditure through enhanced mitochondrial activity and thermogenesis .

How can researchers analyze the differential effects of TMEM86A across adipose tissue depots?

To analyze the effects of TMEM86A across different adipose tissue depots (BAT, iWAT, gWAT), researchers can employ several approaches:

  • Comparative lipidomics: Untargeted phospholipid profiling of different adipose depots, followed by principal component analysis (PCA) to visualize differences in lipid profiles between genotypes and tissue types .

  • Depot-specific gene expression analysis: RT-qPCR and immunoblot analyses to quantify TMEM86A expression levels across different adipose depots under various conditions (e.g., normal diet vs. high-fat diet) .

  • Functional assays: Measurement of mitochondrial content and activity in different adipose depots using techniques such as in situ staining with triphenyltetrazolium chloride (TTC) to assess mitochondrial electron transport .

  • Thermogenic capacity assessment: Infrared imaging to measure surface temperature differences across adipose depots during cold exposure .

These methodological approaches can help researchers understand the depot-specific roles of TMEM86A in adipose tissue biology and metabolism.

What is the potential of TMEM86A as a therapeutic target for obesity-related metabolic diseases?

TMEM86A represents a promising therapeutic target for obesity-related metabolic diseases for several reasons:

  • TMEM86A expression is increased in adipose tissue during obesity and insulin resistance, both in mice and humans .

  • Genetic inactivation of adipocyte TMEM86A increases oxidative metabolism in adipose tissues and improves systemic metabolism during high-fat feeding .

  • Lysoplasmalogen levels (TMEM86A substrates) are significantly lower in adipose tissue of human patients with obesity .

  • Both TMEM86A inhibition (through genetic knockout) and lysoplasmalogen supplementation protect against high-fat diet-induced metabolic dysfunction .

These findings suggest two potential therapeutic approaches: development of specific TMEM86A inhibitors or direct supplementation with lysoplasmalogens, particularly LPE P-18:0 . Researchers pursuing translational applications should focus on developing methods to target TMEM86A specifically in adipose tissue to maximize beneficial metabolic effects while minimizing potential off-target effects.

How can contradictory results in TMEM86A research be reconciled?

When facing contradictory results in TMEM86A research, researchers should consider:

  • Tissue-specific effects: TMEM86A may have different functions in different tissues. Adipocyte-specific knockout results may differ from global knockout or inhibition.

  • Species differences: Human and mouse TMEM86A may have subtle functional differences that affect experimental outcomes.

  • Methodological variations: Different methods for measuring lysoplasmalogen levels or TMEM86A activity may yield different results.

  • Contextual factors: The metabolic context (e.g., diet, age, sex) may significantly influence TMEM86A function and the effects of its manipulation.

When designing experiments to resolve contradictions, researchers should carefully control for these variables and employ multiple complementary approaches to validate their findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.