Recombinant Human Lysoplasmalogenase (TMEM86B)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

TMEM86B encodes a 19 kDa hydrophobic transmembrane protein belonging to the YhhN family . Structural features include:

  • 8 predicted transmembrane domains (AlphaFold model)

  • Catalytic residues: Asp82 and Asp190, essential for enzymatic activity

  • Specificity: Exclusively targets sn-2-deacylated lysoplasmalogens (not intact plasmalogens)

A comparative analysis of enzymatic properties is shown below:

ParameterLysoplasmenylcholineLysoplasmenylethanolamine
Apparent KmK_m (μM)~50~50
Apparent VmaxV_{max}24.5 μmol/min/mg17.5 μmol/min/mg
pH Optimum7.07.0
Inhibitor (Competitive)Lysophosphatidic acid (Ki20μMK_i \sim 20 \, \mu M)

Functional Roles in Lipid Metabolism

Recombinant TMEM86B has been instrumental in elucidating:

  • Plasmalogen regulation: Overexpression in HEK 293T cells reduces cellular plasmalogen levels by 30–40%, confirming its role in lipid homeostasis .

  • Membrane stability: Hydrolyzes cytotoxic lysoplasmalogens, preventing membrane disruption .

  • Disease links: Associated with peroxisomal disorders (e.g., rhizomelic chondrodysplasia punctata) and neurodegenerative conditions .

Recombinant Production Systems

TMEM86B has been expressed in multiple systems:

Expression HostKey FindingsApplication
HEK 293T cells- Localizes to membranes
- Retains enzymatic activity post-transfection
Cell-based lipid metabolism studies
Escherichia coli- Active enzyme confirmed via Western blot and activity assays Bulk protein production
Baculovirus (insect cells)- Used for high-yield purification Structural studies

Mechanistic Insights

  • Substrate preference: Hydrolyzes both choline- and ethanolamine-linked lysoplasmalogens .

  • Metabolic impact: Knockout studies in adipocytes show increased lysoplasmalogen levels and enhanced cAMP/PKA signaling .

Disease Relevance

  • Neurodegeneration: Reduced plasmalogen levels in Alzheimer’s disease correlate with upregulated TMEM86B activity .

  • Cancer: Elevated lysoplasmalogenase activity observed in tumor cell lines .

Research Applications

  • Drug discovery: Screening for inhibitors to modulate plasmalogen levels .

  • Diagnostics: Quantifying lysoplasmalogenase activity in peroxisomal disorder patients .

  • Structural biology: Investigating membrane protein dynamics via cryo-EM .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, kindly indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributors.
Please note: All protein shipments are sent with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For short-term storage (up to one week), working aliquots can be stored at 4°C.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the protein is dependent on various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TMEM86B; Lysoplasmalogenase; Transmembrane protein 86B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM86B
Target Protein Sequence
MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL AGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPL QPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFT LSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD
Uniprot No.

Target Background

Function
Lysoplasmalogenase is an enzyme that catalyzes the degradation of lysoplasmalogens. These lysoplasmalogens are generated by the hydrolysis of plasmalogens, which are abundant membrane glycerophospholipids. This enzyme potentially regulates the cellular levels of plasmalogens and lysoplasmalogens, thereby modulating cell membrane properties.
Gene References Into Functions
  1. Transient transfection of human embryonic kidney (HEK) 293T cells with TMEM86b cDNA demonstrated lysoplasmalogenase activity. Western blot analysis confirmed the synthesis of TMEM86b protein PMID: 21515882
Database Links

HGNC: 28448

OMIM: 617806

KEGG: hsa:255043

STRING: 9606.ENSP00000321038

UniGene: Hs.135215

Protein Families
TMEM86 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

Basic Research Questions

  • What is the biochemical function of human lysoplasmalogenase (TMEM86B)?

    Human lysoplasmalogenase (TMEM86B) catalyzes the hydrolytic cleavage of the vinyl ether bond of lysoplasmalogen, forming a fatty aldehyde and either glycerophosphoethanolamine or glycerophosphocholine. The enzyme is specific for the sn-2-deacylated form of plasmalogen and plays a crucial role in regulating plasmalogen levels in cells. Biochemical characterization has shown that TMEM86B has apparent Km values of approximately 50 μM for both lysoplasmenylcholine and lysoplasmenylethanolamine substrates, with Vmax values of 24.5 and 17.5 μmol/min/mg protein, respectively . Overexpression studies have demonstrated that TMEM86B can decrease cellular plasmalogen levels, highlighting its importance in lipid homeostasis .

  • How does TMEM86B differ structurally and functionally from TMEM86A?

    Both TMEM86A and TMEM86B belong to the YhhN family of proteins and possess lysoplasmalogenase activity, but they differ in tissue distribution and potentially in substrate specificity. TMEM86B is predominantly expressed in the liver, whereas TMEM86A is enriched in adipocytes . Structurally, both proteins are predicted to have multiple transmembrane regions and share evolutionarily conserved catalytic residues. In TMEM86A, aspartate residues D82 and D190 have been identified as critical for catalytic activity . AlphaFold computational modeling predicts that TMEM86A contains 8 transmembrane regions, and by homology, TMEM86B likely has a similar structure . Functionally, TMEM86A has been implicated in adipocyte metabolism and energy homeostasis, with its deletion protecting mice from obesity and insulin resistance .

  • What are the optimal conditions for assessing recombinant TMEM86B enzymatic activity?

    Recombinant TMEM86B exhibits optimal enzymatic activity at pH 7.0 . For in vitro assays, the enzyme requires appropriate detergent conditions for solubilization while maintaining activity, with octyl glucoside being successfully employed for this purpose . Two primary methodological approaches can be used to assess activity:

    MethodApplicationsKey Considerations
    Spectrophotometric coupled assayRoutine activity measurementsLinks aldehydes formed to NAD+ reduction by alcohol dehydrogenase
    Two-dimensional TLCStoichiometric studies, inhibitor assessmentsCan track changes in substrate and multiple products simultaneously

    The enzyme is competitively inhibited by lysophosphatidic acid with a Ki of approximately 20 μM, which should be considered when designing experimental conditions . No cofactors appear necessary for activity.

  • Which expression systems are suitable for producing recombinant human TMEM86B?

    Recombinant TMEM86B has been successfully expressed in multiple systems:

    Expression SystemAdvantagesConsiderations
    HEK293T cellsProper post-translational modificationsRequires optimization of transfection methods
    E. coliHigher yield potential, cost-effectiveMay require refolding strategies for functional protein

    For mammalian expression, transient transfection with appropriate vectors containing TMEM86B cDNA can be employed . In both systems, expression verification should include Western blot analysis and activity assays. When designing expression constructs, consideration should be given to the addition of purification tags (His, FLAG) that do not interfere with enzymatic function. Since TMEM86B is a membrane protein, optimization of solubilization and purification protocols is essential for obtaining active enzyme .

  • What is the subcellular localization of TMEM86B and how can it be studied?

    TMEM86B is predominantly localized to membrane fractions of cells, specifically in the endoplasmic reticulum (ER) membrane . This localization aligns with its function in lipid metabolism, as the ER is a major site for phospholipid synthesis and metabolism. By analogy with TMEM86A, which strongly colocalizes with ER Tracker staining in cells, TMEM86B likely exhibits similar localization patterns .

    Methodological approaches for studying TMEM86B localization include:

    • Subcellular fractionation followed by Western blotting

    • Immunofluorescence microscopy using TMEM86B-specific antibodies

    • Expression of fluorescently tagged TMEM86B (e.g., GFP-TMEM86B) with live-cell imaging

    • Co-localization studies with established ER markers (calnexin, PDI)

    When interpreting localization data, consideration should be given to potential artifacts from overexpression systems versus endogenous protein detection.

Advanced Research Questions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.