Recombinant Human Lysosomal-associated transmembrane protein 4A (LAPTM4A)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Biology

LAPTM4A appears to function primarily in transport mechanisms within cells. According to STRING database information, LAPTM4A "may function in the transport of nucleosides and/or nucleoside derivatives between the cytosol and the lumen of an intracellular membrane-bound compartment" . This function is consistent with its localization to lysosomal membranes.

The protein belongs to the LAPTM4/LAPTM5 transporter family, which includes other lysosomal-associated membrane proteins that serve related functions in cellular transport and signaling . LAPTM4A shows significant functional similarity to LAPTM4B and LAPTM5, with protein interaction scores of 0.919 and 0.916 respectively, indicating highly probable functional relationships .

Studies of mouse homologs suggest that LAPTM4A plays a role in transporting small molecules across endosomal and lysosomal membranes, though the full extent of its physiological function in humans has not yet been completely determined . This transport function may have implications for cellular metabolism, signaling, and homeostasis.

Recombinant LAPTM4A: Production and Applications

Recombinant Human LAPTM4A refers to artificially produced versions of the LAPTM4A protein generated through molecular biology techniques. These recombinant proteins serve as valuable tools for studying the structure, function, and potential clinical applications of LAPTM4A.

Production Systems

Recombinant LAPTM4A is typically produced using mammalian expression systems. HEK-293 cells represent one of the most common expression platforms for generating human LAPTM4A . This cell line is favored because it provides appropriate post-translational modifications that are often crucial for maintaining the native structure and function of human proteins.

The production process generally involves:

  1. Gene synthesis or cloning of the LAPTM4A coding sequence

  2. Insertion into an appropriate expression vector

  3. Transfection into host cells (e.g., HEK-293)

  4. Expression of the recombinant protein

  5. Purification via affinity chromatography, typically using tags such as His-tag

The purified protein typically achieves greater than 90% purity as determined by methods such as Bis-Tris Page and Western Blot .

LAPTM4A in Cancer Biology

Recent research has revealed significant associations between LAPTM4A and various cancers, particularly glioma. These findings highlight the potential importance of this protein in cancer development, progression, and treatment.

Expression in Cancer

LAPTM4A shows differential expression across various cancer types. Analysis of The Cancer Genome Atlas (TCGA) and Genotype Tissue Expression (GTEx) datasets has revealed significant upregulation of LAPTM4A in gliomas, including both low-grade glioma (LGG) and glioblastoma (GBM) . This aberrant expression appears to be associated with several mechanisms:

  1. Promoter hypomethylation: Studies have shown widespread hypomethylation at LAPTM4A promoter sites in glioma samples, with decreasing methylation levels correlating with increasing glioma grades .

  2. Mutation patterns: The predominant mutation pattern observed in LAPTM4A in cancer is amplification, which may contribute to its overexpression .

These findings suggest that epigenetic modifications and genetic alterations both contribute to the dysregulation of LAPTM4A in cancer.

Prognostic Value

LAPTM4A expression demonstrates significant prognostic value in glioma patients. Multiple studies have shown that overexpression of LAPTM4A is associated with:

These associations were consistent across different glioma subtypes, including LGG and GBM. The correlation between high LAPTM4A expression and poor prognosis was validated using both TCGA and Chinese Glioma Genome Atlas (CGGA) databases .

Furthermore, LAPTM4A expression correlates with various clinicopathological features in glioma patients, including tumor grade, histological type, age, 1p/19q codeletion status, IDH mutation status, and response to primary therapy . This suggests that LAPTM4A may play a role in determining the biological behavior of gliomas.

Mechanisms in Cancer Progression

Research into the functional role of LAPTM4A in cancer has revealed several potential mechanisms by which this protein may influence cancer progression and patient outcomes.

Immune Cell Infiltration

LAPTM4A expression shows strong correlations with immune cell infiltration in the tumor microenvironment. Specifically, it demonstrates significant associations with:

  • Neutrophil infiltration

  • Macrophage infiltration

  • Dendritic cell infiltration

These immune cells, particularly macrophages and cancer-associated fibroblasts, create a supportive stroma for tumor cell expansion and invasion. Analysis using the TIMER2 platform has confirmed a significant positive correlation between LAPTM4A expression and monocyte/macrophage and cancer-associated fibroblast infiltration .

Immunotherapy Implications

LAPTM4A shows positive correlations with multiple immune checkpoint (ICP) gene expressions, including well-known markers such as CD274 (PD-L1), PDCD1 (PD-1), and CD80 . These immune checkpoint molecules typically suppress effector T cells, thereby promoting cancer development.

The relationship between LAPTM4A and immunotherapy response has been explored using the Tumor Immune Dysfunction and Exclusion (TIDE) score. Patients with high LAPTM4A expression tend to have higher TIDE scores, suggesting reduced effectiveness of immunotherapy . This indicates that LAPTM4A expression levels might serve as a predictive biomarker for immunotherapy response in glioma patients.

Metastasis and Invasion

In vitro experiments have indicated that LAPTM4A may influence metastasis through the epithelial-mesenchymal transition (EMT) pathway in glioma . This process is critical for cancer cell invasion and metastatic spread. The specific molecular mechanisms underlying this relationship require further investigation.

Diagnostic and Therapeutic Potential

The distinctive expression patterns and functional associations of LAPTM4A in cancer suggest significant potential for diagnostic and therapeutic applications.

Diagnostic Value

LAPTM4A shows remarkable diagnostic accuracy for glioma detection. Receiver Operating Characteristic (ROC) curve analysis has revealed area under the curve values of:

  • 0.982 for LGG

  • 0.992 for GBM

  • 0.984 for combined gliomas (GBMLGG)

These high values indicate excellent sensitivity and specificity for distinguishing glioma tissues from normal brain tissues, suggesting that LAPTM4A could serve as a valuable diagnostic biomarker.

Therapeutic Implications

Drug sensitivity analysis has revealed that patients with high LAPTM4A expression show sensitivity to certain chemotherapeutic agents, particularly doxorubicin, which has been observed to reduce LAPTM4A expression . This finding suggests potential therapeutic strategies targeting LAPTM4A or exploiting its expression patterns.

Additionally, the identification of the FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis as a facilitator of glioma progression provides another potential therapeutic target . Interventions aimed at disrupting this regulatory network might offer novel approaches for glioma treatment.

Molecular Interactions

Understanding the protein-protein interactions of LAPTM4A provides valuable insights into its functional role and potential biological significance.

Predicted Functional Partners

According to STRING database analysis, LAPTM4A interacts with several key proteins, including:

ProteinFunctionInteraction Score
LAPTM4BRequired for optimal lysosomal function; regulates EGFR intraluminal sorting and degradation0.919
LAPTM5May have special functional role during embryogenesis and in adult hematopoietic cells0.916
NEDD4E3 ubiquitin-protein ligase involved in protein degradation pathways0.705
TM9SF2May function as a channel or small molecule transporter in intracellular compartments0.685

These interactions suggest that LAPTM4A functions within a network of proteins involved in lysosomal function, protein degradation, and intracellular transport.

Pathway Associations

Functional enrichment analysis has demonstrated that LAPTM4A plays a role in the immune system and cancer progression pathways . The specific molecular mechanisms through which LAPTM4A influences these pathways remain areas of active investigation.

Future Research Directions

Despite significant advances in understanding LAPTM4A, several important questions remain unanswered. Future research directions might include:

  1. Detailed structural studies: Elucidating the three-dimensional structure of LAPTM4A to better understand its function and potential druggability.

  2. Functional characterization: Further investigating the specific molecules transported by LAPTM4A and the physiological significance of this transport.

  3. Therapeutic targeting: Developing strategies to modulate LAPTM4A expression or function for cancer treatment, particularly in gliomas.

  4. Expanded cancer studies: Exploring the role of LAPTM4A in cancer types beyond glioma to determine whether its significance extends to other malignancies.

  5. Mechanism studies: Investigating the precise molecular mechanisms through which LAPTM4A influences immune cell infiltration and the tumor microenvironment.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
LAPTM4A; KIAA0108; LAPTM4; MBNT; MTRP; UNQ1846/PRO3574; Lysosomal-associated transmembrane protein 4A; Golgi 4-transmembrane-spanning transporter MTP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LAPTM4A
Target Protein Sequence
MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDF VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLI NCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA
Uniprot No.

Target Background

Function
LAPTM4A may play a role in the transport of nucleosides and/or nucleoside derivatives between the cytosol and the lumen of intracellular membrane-bound compartments.
Gene References Into Functions
  1. hOCT2 interacts with LAPTM4A in lysosomes and late endosomes, contributing to the regulation of endocytotic recruitment. PMID: 21553234
Database Links

HGNC: 6924

KEGG: hsa:9741

STRING: 9606.ENSP00000175091

UniGene: Hs.467807

Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein.

Q&A

What is LAPTM4A and how is it characterized in research settings?

LAPTM4A (lysosomal protein transmembrane 4A) is a transmembrane protein primarily localized in lysosomes. In research contexts, it can be characterized through various molecular techniques including differential gene expression analysis, protein detection methods, and localization studies. Recent bioinformatic analyses using The Cancer Genome Atlas (TCGA) and Genotype Tissue Expression (GTEx) datasets have facilitated comprehensive characterization of LAPTM4A expression across different tissues and cancer types . For molecular research, recombinant LAPTM4A can be produced through standard protein expression systems, typically using mammalian expression vectors containing the human LAPTM4A gene.

How is LAPTM4A expression analyzed across different tissue types?

LAPTM4A expression can be systematically evaluated using RNA sequencing data from databases such as TCGA and GTEx. Researchers have documented significantly elevated LAPTM4A expression across 16 different carcinoma types, with particularly high expression in brain tumors including lower-grade glioma (LGG), glioblastoma multiforme (GBM), and combined glioblastoma and lower-grade glioma (GBMLGG) . For experimental validation, quantitative RT-PCR and Western blotting are commonly employed to measure LAPTM4A expression at mRNA and protein levels, respectively. In situ hybridization and immunohistochemistry can provide spatial information about LAPTM4A expression within tissue sections.

What experimental models are available for studying LAPTM4A function?

Research on LAPTM4A typically employs several model systems:

  • Cell lines: Human glioma cell lines such as U251 have been validated for LAPTM4A studies

  • Knockdown models: Plasmid-mediated knockdown of LAPTM4A through shRNA approaches

  • Patient-derived samples: Direct analysis of tumor tissues through single-cell sequencing

  • Bioinformatic models: In silico analyses using cancer databases (TCGA, CGGA, GTEx)

When selecting a model system, researchers should consider the specific research question, as each model offers different advantages for understanding expression patterns, functional roles, or clinical correlations .

How does LAPTM4A expression correlate with clinical parameters in glioma?

LAPTM4A expression shows significant correlations with multiple clinicopathological features in glioma:

Clinical ParameterLAPTM4A Expression CorrelationStatistical Significance
WHO GradeIncreases with higher gradep < 0.01
IDH StatusHigher in wildtype vs. mutantp < 0.01
1p19q CodeletionHigher in non-codeletion vs. codeletionp < 0.01
AgeVaries by age groupp < 0.01
GenderNo significant correlationNot significant
Survival EventsAssociated with poor outcomesp < 0.01
Primary Therapy OutcomeAssociated with treatment responsep < 0.01

These correlations suggest that LAPTM4A expression is intimately linked to glioma progression and may serve as a valuable prognostic indicator. Research methodologies should include multivariate analysis to control for confounding factors when evaluating LAPTM4A's independent prognostic value .

What is the prognostic value of LAPTM4A in glioma research?

The diagnostic accuracy of LAPTM4A is exceptional, with area under the ROC curve values of 0.982, 0.992, and 0.984 for LGG, GBM, and GBMLGG, respectively . For researchers studying prognostic biomarkers, LAPTM4A represents a robust candidate that can be incorporated into predictive models. A methodological approach using nomograms integrating LAPTM4A expression with other clinical parameters demonstrates close agreement between predicted and actual 1, 3, and 5-year survival durations.

How does LAPTM4A influence tumor invasion and migration in experimental models?

LAPTM4A appears to modulate tumor invasion and migration through the epithelial-mesenchymal transition (EMT) pathway. In experimental knockdown studies using the U251 glioma cell line, reduced LAPTM4A expression resulted in:

  • Increased E-cadherin protein expression (epithelial marker)

  • Decreased N-cadherin and MMP9 protein levels (mesenchymal markers)

  • Inhibited invasion and migration capabilities in Transwell assays

These findings suggest a mechanistic link between LAPTM4A and the EMT process, which is critical for cancer cell motility and invasiveness. For researchers investigating invasion mechanisms, LAPTM4A knockdown models provide valuable insights into potential intervention targets. Experimental approaches should include both protein expression analysis (Western blotting) and functional assays (Transwell migration/invasion) to comprehensively evaluate LAPTM4A's impact on metastatic potential .

What signaling pathways interact with LAPTM4A in glioma?

Functional enrichment analysis has identified several key pathways associated with LAPTM4A in glioma:

Biological Process CategoryAssociated Pathways
Immune-relatedNeutrophil-mediated immunity, acute inflammatory response, interferon production, regulation of immune effector processes, humoral immune response
Cancer-relatedEpithelial-mesenchymal transition, tumor microenvironment interactions
Molecular PathwaysComplement and coagulation cascades, phagocytic vesicles, antigen processing and presentation, cytokine-cytokine receptor interactions, lysosomal pathways

Researchers investigating LAPTM4A-associated pathways should employ pathway enrichment analyses (GO and KEGG) combined with experimental validation through protein-protein interaction studies or pathway inhibition experiments .

What is the relationship between LAPTM4A and glioma molecular subtypes?

LAPTM4A expression varies significantly across glioma molecular subtypes, with the highest expression observed in the mesenchymal subtype. Analysis of multiple datasets (Bao, Phillips, and Rembrandt) confirms this pattern, with LAPTM4A showing strong diagnostic power for the mesenchymal phenotype (AUC values of 0.859, 0.815, and 0.790, respectively) .

This association is particularly relevant as mesenchymal GBM cells exhibit enhanced motility, invasion capabilities, and higher expression of cell movement-related proteins compared to other subtypes. For researchers studying glioma subtype classification, LAPTM4A represents a potential marker for the aggressive mesenchymal phenotype, which is characterized by resistance to conventional therapy .

How can researchers analyze LAPTM4A expression at the single-cell level in the tumor microenvironment?

Single-cell analysis methodologies are essential for understanding LAPTM4A's distribution within the heterogeneous tumor microenvironment. Research approaches include:

  • Single-cell RNA sequencing of tumor samples

  • Analysis using specialized platforms (e.g., the TISCH online tool)

  • Cell type identification and expression mapping

  • Correlation with cell-specific markers

What is the relationship between LAPTM4A and tumor immune cell infiltration?

LAPTM4A expression shows significant positive correlations with various immune cell populations in the tumor microenvironment. Using the TIMER method, researchers have identified strong associations between LAPTM4A and:

  • Neutrophils, macrophages, and dendritic cells (strong correlation)

  • B cells, CD4+ T cells, and CD8+ T cells (mild correlation)

Further analysis using TIMER2 demonstrates positive correlations between LAPTM4A expression and infiltration levels of:

Immune Cell TypeCorrelation in LGGCorrelation in GBM
Common lymphoid progenitorPositivePositive
Cancer-associated fibroblastPositivePositive
MacrophagePositivePositive
MonocytePositiveVariable
NeutrophilPositiveVariable
NK cellsNegativeNegative
T cells CD4+ Th1NegativeNegative

These patterns suggest that LAPTM4A may influence immune recruitment or function within the tumor microenvironment. Researchers studying tumor immunology should consider LAPTM4A as a potential modulator of the immune landscape in gliomas .

How does LAPTM4A expression correlate with tumor microenvironment scores?

LAPTM4A expression positively correlates with various tumor microenvironment metrics derived from the ESTIMATE algorithm:

  • Stromal scores (measuring stromal cell presence)

  • Immune scores (measuring immune cell infiltration)

  • ESTIMATE scores (combined score)

The correlation is particularly strong in GBMLGG (correlation coefficient >0.5), suggesting LAPTM4A's integral role in shaping the tumor microenvironment . For researchers studying the tumor microenvironment, this correlation provides a rationale for investigating LAPTM4A as a potential regulator of tumor-stroma-immune interactions.

How does LAPTM4A expression relate to immune checkpoint expression and immunotherapy response?

LAPTM4A expression shows significant correlations with multiple immune checkpoint genes. High LAPTM4A expression is associated with upregulation of several immune checkpoint genes, with particularly strong correlations with PDCD1LG2, CD274, and HAVCR2 . This pattern suggests potential implications for immunotherapy strategies.

Using the TIDE (Tumor Immune Dysfunction and Exclusion) algorithm, researchers have determined that high LAPTM4A expression is associated with higher TIDE scores in GBMLGG, indicating a potentially diminished response to immune checkpoint blockade therapy . This finding positions LAPTM4A as a risk factor that may predict immunotherapy resistance.

For researchers developing immunotherapeutic approaches, LAPTM4A expression may serve as a biomarker for patient stratification, with downregulation of LAPTM4A potentially enhancing immunotherapy efficacy. Research methodologies should incorporate immune checkpoint gene correlation analysis and TIDE score calculation to evaluate LAPTM4A's impact on immunotherapy response.

What experimental approaches can be used to study LAPTM4A's impact on immune cell function?

To investigate LAPTM4A's functional impact on immune cells, researchers can employ:

  • Co-culture systems with immune and tumor cells

  • LAPTM4A manipulation (knockdown/overexpression) followed by immune cell functional assays

  • Flow cytometry to measure immune cell activation markers

  • Cytokine profiling to assess immune response patterns

  • In vivo models with immune cell depletion or reconstitution

These approaches can help elucidate how LAPTM4A influences immune cell recruitment, activation, and function within the tumor microenvironment. Given LAPTM4A's predominant expression in monocytes/macrophages, particular attention should be paid to myeloid cell populations when designing experimental protocols .

How does LAPTM4A expression affect drug sensitivity in cancer cells?

LAPTM4A expression significantly influences drug sensitivity profiles across multiple datasets:

  • CTD database: 35 small-molecule drugs regulate LAPTM4A expression

  • CGP2016 database: High LAPTM4A expression correlates with increased sensitivity to doxorubicin

  • GSCA analysis: High LAPTM4A expression is associated with resistance to 41 small-molecule drugs

Integrated analysis across databases identified doxorubicin as a particularly promising agent that can both downregulate LAPTM4A expression and show efficacy in high LAPTM4A-expressing tumors . For researchers studying drug resistance mechanisms, LAPTM4A represents a potential biomarker for predicting treatment response and a target for therapeutic intervention.

What are the methodological considerations for studying LAPTM4A in drug screening experiments?

When designing drug screening experiments focused on LAPTM4A, researchers should consider:

  • Expression level stratification: Group samples by LAPTM4A expression levels

  • Multi-drug panels: Test diverse classes of compounds

  • IC50 determination: Calculate half-maximal inhibitory concentrations

  • Expression modulation analysis: Measure how drugs affect LAPTM4A levels

  • Combination approaches: Test drugs alongside LAPTM4A knockdown/overexpression

  • Validation across datasets: Compare results across multiple databases (CTD, CGP2016, GSCA)

This methodological framework can help identify compounds that effectively target LAPTM4A-expressing cells or modulate LAPTM4A expression levels. Particular attention should be given to compounds like doxorubicin that have shown promising results in preliminary analyses .

How can researchers develop ceRNA networks involving LAPTM4A?

Competitive endogenous RNA (ceRNA) networks involving LAPTM4A provide insights into its post-transcriptional regulation. Research has identified the FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis as a facilitator of glioma progression . To investigate ceRNA networks:

  • Identify miRNAs targeting LAPTM4A through bioinformatic prediction

  • Validate miRNA-LAPTM4A interactions through luciferase reporter assays

  • Identify competing RNAs (e.g., lncRNAs, circRNAs) that bind the same miRNAs

  • Establish expression correlations between LAPTM4A, miRNAs, and competing RNAs

  • Perform functional assays to confirm regulatory relationships

This approach can uncover complex regulatory networks controlling LAPTM4A expression and function, potentially identifying novel therapeutic targets or biomarkers. The identified FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis represents a starting point for more comprehensive ceRNA network analysis in glioma and potentially other cancer types .

What are the challenges in translating LAPTM4A research to clinical applications?

Despite promising research findings, several challenges exist in translating LAPTM4A research to clinical applications:

  • Heterogeneity: LAPTM4A expression varies across tumor types, grades, and molecular subtypes

  • Causality: Establishing whether LAPTM4A alterations are drivers or consequences of cancer progression

  • Specificity: Determining LAPTM4A's roles in normal vs. malignant tissues

  • Technical challenges: Optimizing detection methods for clinical implementation

  • Therapeutic targeting: Developing specific modulators of LAPTM4A function

  • Biomarker validation: Confirming prognostic/predictive value in prospective clinical trials

Addressing these challenges requires integrated approaches combining:

  • Multi-omics data integration

  • Rigorous validation across independent cohorts

  • Development of standardized assays for clinical implementation

  • Preclinical models for therapeutic testing

The promising correlations between LAPTM4A and clinical outcomes, particularly in glioma, suggest that overcoming these challenges could yield valuable clinical applications .

What are the most promising future research directions for LAPTM4A?

Based on current findings, the most promising research directions for LAPTM4A include:

  • Exploration of its role in immunotherapy resistance and potential combination strategies

  • Development of LAPTM4A-targeted therapeutics, particularly in combination with doxorubicin

  • Further characterization of the FGD5-AS1-hsa-miR-103a-3p-LAPTM4A regulatory axis

  • Investigation of LAPTM4A's functions in specific immune cell populations

  • Expansion of research beyond glioma to other cancer types with high LAPTM4A expression

  • Integration of LAPTM4A into multi-marker prognostic panels for clinical use

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.