Recombinant Human Lysosomal-associated transmembrane protein 4B (LAPTM4B)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

Recombinant LAPTM4B has been instrumental in elucidating the protein’s biological functions:

  • Lysosomal Leucine Transport: Recruits the LAT1-4F2hc transporter to lysosomes, enabling leucine uptake and mTORC1 activation .

  • EGFR Regulation:

    • Blocks EGFR degradation by inhibiting its lysosomal sorting .

    • Modulates phosphatidylinositol 4,5-bisphosphate interactions to influence EGFR stability .

  • Autophagy and Stress Survival: Promotes autophagy under nutrient deprivation by upregulating ATG3, enhancing tumor cell survival .

  • Immune Modulation: Suppresses TGF-β1 production in regulatory T cells (Tregs), reducing immunosuppression .

Applications in Research

Recombinant LAPTM4B is widely used in:

  • Diagnostic Assays: ELISA and Western blot (WB) for detecting LAPTM4B in serum, where elevated levels correlate with breast cancer progression .

  • Mechanistic Studies:

    • Investigated in HCC models to demonstrate its role in tumor growth and autophagy .

    • Used to study anthracycline resistance in breast cancer via cytoplasmic drug sequestration .

Table 2: Key Research Findings Using Recombinant LAPTM4B

Study FocusFindingsReference
Breast CancerSerum LAPTM4B levels differentiate malignant vs. benign cases (AUC: 0.912) . Post-treatment reductions correlate with therapy efficacy .
Hepatocellular CarcinomaSilencing LAPTM4B inhibits tumor growth in vivo and induces G0/G1 cell-cycle arrest .
Immune RegulationBinds GARP to reduce TGF-β1 secretion by Tregs, suggesting immunotherapeutic targets .
Drug ResistanceOverexpression reduces anthracycline nuclear uptake, increasing chemoresistance .

Future Directions

  • Therapeutic Targeting: Inhibitors of LAPTM4B could enhance chemotherapy efficacy by reversing lysosomal drug sequestration .

  • Biomarker Development: Serum LAPTM4B shows promise as a non-invasive diagnostic tool for breast and liver cancers .

  • Immune Modulation: Targeting LAPTM4B in Tregs may alleviate immunosuppression in autoimmune diseases or cancer .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
LAPTM4B; PSEC0001; Lysosomal-associated transmembrane protein 4B; Lysosome-associated transmembrane protein 4-beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LAPTM4B
Target Protein Sequence
MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRV TWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRR GGLQARRSTLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIIN AVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQ RAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVL IILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAA KEPPPPYVSA
Uniprot No.

Target Background

Function
LAPTM4B is crucial for optimal lysosomal function. It inhibits EGF-stimulated EGFR intraluminal sorting and degradation. Additionally, by binding to phosphatidylinositol 4,5-bisphosphate, it regulates PIP5K1C interaction, inhibits HGS ubiquitination, and relieves LAPTM4B-mediated inhibition of EGFR degradation. LAPTM4B recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, facilitating the entry of leucine and other essential amino acids (EAAs) into the lysosome. This process stimulates activation of the proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and consequently activates mTORC1. LAPTM4B also plays a role as a negative regulator of TGFB1 production in regulatory T cells. It binds ceramide and facilitates its exit from late endosomes, thereby controlling cell death pathways.
Gene References Into Functions
  1. Our research highlights the LAPTM4B gene as a diagnostic biomarker in hepatocellular carcinoma patients with documented chronic hepatitis C virus infection. PMID: 29882487
  2. LAPTM4B plays a significant role in promoting hepatocarcinogenesis and cancer progression. It may serve as a biomarker for the diagnosis and monitoring of hepatocellular carcinoma. PMID: 29108920
  3. Findings suggest that lysosome-associated transmembrane protein 4B (LAPTM4B), vascular endothelial growth factor (VEGF), and nuclear survivin expression are significantly correlated in breast cancer. This correlation may have prognostic value and could identify effective therapeutic targets for anticancer therapies. PMID: 28476037
  4. LAPTM4B-35 is a novel cancer-driving protein that can be inhibited by ethylglyoxal bisthiosemicarbazon. PMID: 27542271
  5. The overexpression of LAPTM4B-35 is an independent prognostic biomarker for non-small-cell lung cancer, predicting cancer recurrence and poor overall survival. PMID: 27486880
  6. Our study shows that LAPTM4B-35 overexpression is strongly associated with tumor proliferation, tumor angiogenesis, and poor outcomes in GBM patients. PMID: 28097442
  7. Our findings suggest that the LAPTM4B allele *1 is a risk factor associated with poor prognosis in colon cancer patients, but not in patients with rectal or esophageal cancers. LAPTM4B genotype status could potentially be a useful prognostic indicator for patients requiring surgical intervention in colon cancer. PMID: 27391361
  8. Our results indicate that the LAPTM4B*2 allele is associated with a heightened risk of pancreatic carcinoma. Carrying this allele might be a predisposing factor for Chinese pancreatic carcinoma patients. PMID: 28618967
  9. A high expression level of LAPTM4B predicts tumor metastatic potential in breast cancer patients. PMID: 28245476
  10. Cox analysis revealed that combined LAPTM4B-35 and VEGF expression is an independent factor for both overall survival and disease-free survival. Overexpression of LAPTM4B-35 along with positive VEGF expression may serve as a novel biological marker to predict the prognosis of cervical carcinoma patients. PMID: 26526574
  11. Compared to control cells, LAPTM4B-miRNA-transfected NIH:OVCAR3 cells exhibited significant decreases in cell motility and invasion. Furthermore, LAPTM4B depletion resulted in a notable decrease in proliferating cell nuclear antigen, vascular endothelial growth factor, MMP2, MMP9, and CDK12 expression. PMID: 26247403
  12. Our findings provide evidence that LAPTM4B plays a crucial role in promoting tumor angiogenesis. PMID: 26383850
  13. Our study underscores the relevance of LAPTM4B expression to NSCLC pathogenesis and suggests a probable role of LAPTM4B/NRF2 signaling in promoting lung cancer cell survival. PMID: 26343532
  14. LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to the uptake of leucine into lysosomes. PMID: 25998567
  15. Our findings suggest that LAPTM4B-35 overexpression might be linked to GC progression and poor prognosis, potentially serving as a new prediction marker for GC patients. PMID: 25849595
  16. We found that restoring miR-188-5p can inhibit the PI3K/AKT signaling pathway by suppressing LAPTM4B. PMID: 25714029
  17. LAPTM4B-35 overexpression is associated with small cell lung cancer. PMID: 25910706
  18. LAPTM4B-35 over-expression is an independent factor in gastric carcinoma prognosis. PMID: 25689860
  19. By compartmentalizing ceramide, LAPTM4B controls key sphingolipid-mediated cell death mechanisms, making it a potential target for sphingolipid-targeting cancer therapies. PMID: 26280656
  20. LAPTM4B binds to GARP and acts as a negative regulator of TGF-beta1 production in human Tregs. PMID: 26126825
  21. We did not observe any association between LAPTM4B polymorphism and the risk of breast cancer in a sample of the Iranian population. PMID: 25001088
  22. Overexpression of LAPTM4B protein is correlated with tumor angiogenesis and poor prognosis in non-small cell lung cancer. PMID: 24816841
  23. Our research reveals a critical aspect of EGFR trafficking regulated by LAPTM4B, PtdIns(4,5)P2 signaling, and the ESCRT complex. This discovery clarifies a mechanism by which the oncoprotein LAPTM4B can transform cells and promote tumor progression. PMID: 25588945
  24. LAPTM4B-35 is consistently expressed in gastric cancer and is associated with specific clinicopathological and immunohistochemical characteristics. PMID: 25416438
  25. Our results suggest that LAPTM4B polymorphisms may be a prospective marker for assessing the risk and prognosis of non-small cell lung cancer. PMID: 24676601
  26. Overexpression of LAPTM4B-35 may be associated with tumor progression and poor prognosis in prostate cancer. PMID: 24651764
  27. The LAPTM4B *2 allele was associated with an increased risk of multiple cancers, tumor initiation, and development in Chinese populations. [meta-analysis] PMID: 24746178
  28. LAPTM4B, with increased expression in airways closer to tumors, was upregulated in human immortalized cells compared with normal bronchial epithelial cells. It promotes anchorage-dependent and independent lung cancer cell growth. PMID: 24563515
  29. LAPTM4B did not exhibit any expression changes between different classes of pituitary adenomas. PMID: 23023342
  30. SNPs in lysosomal-associated transmembrane protein 4 beta (LAPTM4B) and insulin-like growth factor 1 (IGF1) were associated with both susceptibility to and curve severity in adolescent idiopathic scoliosis in Korea. PMID: 23364988
  31. Our study identified the core promoter region responsible for constitutive expression of LAPTM4B. We also clarified that CREB1 played a significant role in LAPTM4B transcriptional regulation in human breast cancer cells. PMID: 23469012
  32. The LAPTM4B allele *2 might be a risk factor associated with genetic susceptibility to GBC. PMID: 22302286
  33. Endometrial carcinoma patients carrying the LAPTM4B *2 variant had significantly shorter overall survival and disease-free survival. PMID: 23312008
  34. Our study indicated that the polymorphism of the LAPTM4B gene did not influence the susceptibility of nasopharyngeal carcinoma in the Chinese population. PMID: 23345117
  35. The LAPTM4B allele *2 appears to be associated with genetic susceptibility to HCC and may be considered a risk factor. PMID: 22207410
  36. High LAPTM4B expression is associated with lymph node metastasis and recurrence in breast cancer. PMID: 23292099
  37. The LAPTM4B*2 allele is a risk factor associated with breast cancer susceptibility and poor prognosis. PMID: 22984585
  38. Our data suggest that lysosomal protein transmembrane 4 beta (LAPTM4B) status may be useful in the preoperative evaluation of the operability of gallbladder carcinoma (GBC). PMID: 22984631
  39. LAPTM4B-35 was found to be present at high levels in a significant proportion of patients with pancreatic carcinoma and was closely related to disease progression and poor prognosis. PMID: 22971479
  40. LAPTM4B overexpression is an independent factor in poor colorectal cancer prognosis and may be an important potential biomarker. PMID: 22578410
  41. LAPTM4B allelic variation was significantly associated with breast cancer occurrence, with adjusted odds ratios of 1.387 (95%CI = 1.111-1.730) for LAPTM4B*1/2 and 1.592 (95% CI = 1.043-2.430) for LAPTM4B*2/2 genotype. PMID: 22270081
  42. Gene polymorphism of LAPTM4B may influence individuals' susceptibility to primary liver cancer. PMID: 22156622
  43. LAPTM4B expression was found to have a significant inverse correlation on prognosis in patients with metastatic ovarian tumors and may be an independent prognostic marker for metastatic ovarian tumors. PMID: 22193644
  44. LAPTM4B is a risk factor associated with poor prognosis in patients with resected HCC. LAPTM4B status may be useful preoperatively as an adjunct in evaluating the operability of HCC. PMID: 22509374
  45. Our data indicate that the LAPTM4B 2 allele may be a risk factor for ovarian cancer and may play a significant role in genetic susceptibility to ovarian cancer. PMID: 22412199
  46. Our data show that LAPTM4B protein was localized in lysosomes, where its depletion increased membrane permeability, pH, cathepsin release, and cellular apoptosis. PMID: 22037872
  47. Upregulation of LAPTM4B-35 promotes malignant transformation and liver tumorigenesis. PMID: 21618708
  48. Overexpression of LAPTM4B-35 attenuated epirubicin-induced apoptosis of gallbladder carcinoma GBC-SD cells through a mitochondria-dependent pathway. PMID: 21429547
  49. The LAPTM4B*2 allele might be a cervical cancer risk factor and may play a significant role in genetic susceptibility to cervical cancer in the Chinese population. PMID: 21656743
  50. Over-expression of LAPTM4B is associated with chemotherapy resistance and stages III and IV epithelial ovarian cancer. PMID: 21416470

Show More

Hide All

Database Links

HGNC: 13646

OMIM: 613296

KEGG: hsa:55353

STRING: 9606.ENSP00000402301

UniGene: Hs.492314

Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Late endosome membrane. Cell membrane. Cell projection. Lysosome membrane. Endosome membrane. Endosome, multivesicular body membrane. Endosome, multivesicular body lumen.

Q&A

What is LAPTM4B and where is it primarily expressed?

LAPTM4B (Lysosomal-associated transmembrane protein 4B) is an integral membrane protein that was initially identified in hepatocellular carcinoma (HCC) . It is primarily expressed in the cytoplasm and membrane of cells, with varying expression levels across different tissues . In cancer tissues, such as bladder cancer, LAPTM4B shows elevated expression compared to corresponding non-tumor tissues . At the subcellular level, LAPTM4B localizes predominantly in the median Golgi apparatus, as observed in transfected cell lines . The protein contains C-terminal polyproline-tyrosine (PY) motifs which may target it to lysosomes, similar to other LAPTM family members .

What are the known isoforms of LAPTM4B and their significance?

Research has identified at least two isoforms of LAPTM4B: iso24 and iso20 . These isoforms have been used in experimental settings to evaluate LAPTM4B's influence on TGF-β1 production regulation. Both isoforms appear to function similarly in decreasing the cleavage of proTGF-β1, secretion of latent TGF-β1, and surface presentation of GARP-latent TGF-β1 complexes . The differential expression or functional variations between these isoforms in physiological or pathological conditions require further investigation for comprehensive understanding of their specific roles.

How does LAPTM4B contribute to normal cellular functions?

LAPTM4B plays important roles in various cellular processes including:

  • Regulation of immune responses: LAPTM4B binds to glycoprotein A repetitions predominant (GARP) and functions as a negative regulator of TGF-β1 production in human regulatory T cells (Tregs) . This regulation impacts immunosuppression mediated by Tregs.

  • Autophagy regulation: LAPTM4B is critical for autophagic maturation, with overexpression promoting autophagy . This function may contribute to cell survival under stress conditions.

  • Membrane protein trafficking: Similar to other LAPTM family members, LAPTM4B may regulate surface levels of transmembrane proteins through interactions with its PY motifs .

  • Sphingolipid metabolism: Previous studies have shown that LAPTM4B can interact with ceramide to promote its removal from late endosomal organelles, thereby regulating sphingolipid-mediated cell death processes .

How does LAPTM4B interact with the TGF-β1 pathway in regulatory T cells?

LAPTM4B regulates TGF-β1 production in Tregs through multiple mechanisms:

  • Interaction with GARP: LAPTM4B directly binds to GARP, a receptor for latent TGF-β1 expressed on stimulated Tregs . This interaction was identified through yeast two-hybrid assay using GARP as bait to screen a human Treg cDNA library.

  • Inhibition of proTGF-β1 cleavage: LAPTM4B decreases the GARP-induced cleavage of proTGF-β1 into latent TGF-β1, as demonstrated by Western blot analysis. When LAPTM4B is co-expressed with GARP in 293T cells, the detection of LAP and mature TGF-β1 is reduced compared to cells expressing GARP alone .

  • Reduction of surface GARP levels: LAPTM4B reduces surface GARP levels by approximately 45% and surface GARP·latent TGF-β1 complexes by 73% in co-transfected cells, as measured by flow cytometry . This mechanism appears to be specific to GARP, as surface levels of unrelated proteins like HLA-A2 or CD9 remain unaffected.

  • Inhibition of latent TGF-β1 secretion: LAPTM4B decreases the secretion of soluble latent TGF-β1 by Tregs, which may occur through both GARP-dependent and GARP-independent mechanisms .

Importantly, while LAPTM4B negatively regulates TGF-β1 production, it does not contribute to TGF-β1 activation, as demonstrated by luciferase reporter assays with SMAD2/3-responsive elements .

What signaling pathways does LAPTM4B influence in cancer progression?

LAPTM4B modulates several signaling pathways that contribute to cancer progression:

  • PI3K/AKT pathway: LAPTM4B, in cooperation with AP4, activates the PI3K/AKT signaling pathway in hepatocellular carcinoma, promoting proliferation and invasion .

  • EGFR signaling: In gastric cancer, LAPTM4B promotes cancer development via EGFR over-activation, a process that is repressed by Beclin1 .

  • Caspase-dependent pathway: LAPTM4B influences apoptotic processes through regulation of the caspase-dependent pathway .

  • Autophagy regulation: By promoting autophagic maturation, LAPTM4B can enhance cancer cell survival under stress conditions and contribute to proliferation .

  • Sphingolipid metabolism: LAPTM4B's interaction with ceramide affects sphingolipid-mediated cell death processes, potentially contributing to cancer cell resistance to apoptosis .

The specific mechanisms through which LAPTM4B regulates these pathways in different cancer types require further investigation through pathway inhibition studies, co-immunoprecipitation, and other molecular approaches.

What methods are most effective for detecting LAPTM4B expression in clinical samples?

Several methods have proven effective for detecting LAPTM4B in clinical samples:

  • Immunohistochemistry (IHC): This method has been successfully used to detect LAPTM4B expression in tumor tissues from patients with bladder cancer. The protein is mainly observed in the cytoplasm and membrane of cancer cells . IHC allows for classification of samples into low and high expression groups based on staining intensity.

  • Enzyme-Linked Immunosorbent Assay (ELISA): ELISA has been employed to measure serum LAPTM4B levels in breast cancer patients, benign breast disease patients, and healthy controls . This approach allows for quantitative assessment of circulating LAPTM4B.

  • Western Blot Analysis: For experimental settings, Western blot analysis has been utilized to detect LAPTM4B protein levels and evaluate its effects on proTGF-β1 cleavage .

  • Flow Cytometry: This technique has been used to examine surface levels of LAPTM4B and its impact on other surface proteins like GARP .

When implementing these methods, researchers should consider appropriate controls, antibody validation, and standardization of protocols to ensure reliable and reproducible results.

How should LAPTM4B expression data be interpreted in clinical studies?

Interpretation of LAPTM4B expression data in clinical studies requires careful consideration of several factors:

The table below summarizes the relationship between LAPTM4B expression and clinicopathological features in bladder cancer:

CharacteristicLAPTM4B Expressionχ²P-value
Total numberLow n=34High n=77
Age, years2.1990.138
<55441727
≥55671750
Tumor stage8.5160.004
T2522329
T3/T4591148
Recurrence5.9830.014
Yes521042
No592435

How can LAPTM4B be manipulated in experimental systems to study its function?

Researchers can manipulate LAPTM4B in experimental systems through several approaches:

  • Overexpression systems: Transfection of LAPTM4B expression constructs (for both iso24 and iso20 variants) into cell lines such as 293T cells has been used to study its effects on TGF-β1 production and regulation . This approach allows for assessment of gain-of-function effects.

  • Knockdown techniques: siRNA or shRNA targeting LAPTM4B can be employed to reduce its expression in cancer cell lines, enabling investigation of loss-of-function effects on proliferation, migration, and invasion .

  • Co-expression systems: Co-transfection of LAPTM4B with interaction partners like GARP and TGF-β1 in cell lines provides insights into protein-protein interactions and functional consequences .

  • Reporter assays: Luciferase reporter systems (e.g., CAGA-LUC reporter) combined with LAPTM4B manipulation can be used to assess effects on specific signaling pathways like TGF-β1/SMAD signaling .

  • Animal models: Development of LAPTM4B knockout or transgenic animals would provide valuable in vivo systems to study its physiological and pathological roles.

When implementing these approaches, researchers should include appropriate controls and validate the efficiency of overexpression or knockdown through methods like Western blotting or qPCR.

What are the critical considerations for designing experiments to study LAPTM4B in cancer models?

When designing experiments to investigate LAPTM4B in cancer models, researchers should consider:

  • Selection of appropriate cell lines: Choose cell lines that either naturally express high levels of LAPTM4B (for knockdown studies) or have low endogenous expression (for overexpression studies). The cellular context may significantly influence LAPTM4B function.

  • In vitro vs. in vivo models: Determine whether cell culture models are sufficient or if animal models are necessary to address the research question. For studying metastasis and tumor growth, in vivo models may be essential .

  • Functional readouts: Select relevant assays to measure proliferation, migration, invasion, apoptosis, or autophagy based on known LAPTM4B functions .

  • Pathway analysis: Include experiments to delineate the specific signaling pathways affected by LAPTM4B, such as PI3K/AKT, EGFR, or autophagy pathways .

  • Protein interaction studies: Consider co-immunoprecipitation, proximity ligation assays, or FRET to identify and validate LAPTM4B binding partners like GARP .

  • Subcellular localization: Include studies on the intracellular distribution of LAPTM4B using fractionation or immunofluorescence microscopy to understand its site of action .

  • Clinical relevance: Design experiments that address questions with potential clinical implications, such as the relationship between LAPTM4B expression and treatment response or metastasis .

  • Temporal considerations: Account for dynamic changes in LAPTM4B expression or function over time, particularly in response to treatments or during disease progression .

How reliable is LAPTM4B as a diagnostic biomarker for cancer detection?

The reliability of LAPTM4B as a diagnostic biomarker varies by cancer type and detection method:

For breast cancer, serum LAPTM4B demonstrates promising diagnostic potential:

  • The receiver operator characteristic (ROC) curve analysis showed an area under the curve (AUC) of 0.912

  • Sensitivity of 85.9% and specificity of 83.8% in discriminating breast cancer from healthy controls

  • Significantly elevated levels in breast cancer patients compared to benign breast disease patients and healthy controls

For other cancers such as bladder cancer, tissue-based detection through immunohistochemistry has shown:

  • Significantly higher expression in tumor tissues compared to corresponding non-tumor tissues

  • Association with clinical features including tumor stage (P=0.004) and recurrence (P=0.014)

The reliability of LAPTM4B as a biomarker can be enhanced by:

  • Standardization of detection methods across laboratories

  • Establishment of clear cutoff values for positive/negative results

  • Combination with other established biomarkers to improve sensitivity and specificity

  • Validation in large, diverse patient cohorts

What is the potential of LAPTM4B as a prognostic and predictive biomarker in cancer treatment?

LAPTM4B shows considerable promise as both a prognostic and predictive biomarker:

As a prognostic biomarker:

As a predictive biomarker:

  • Serum LAPTM4B levels significantly decrease after adjuvant therapy in breast cancer patients

  • Patients with invalid response to treatment (progressive disease or stable disease) show higher LAPTM4B levels compared to those with valid response (partial or complete response)

  • The dynamic changes in LAPTM4B levels during treatment may provide valuable information about treatment efficacy

For implementation in clinical research, several considerations are important:

  • Serial monitoring of LAPTM4B levels before, during, and after treatment

  • Correlation of changes in LAPTM4B levels with clinical response

  • Investigation of tissue-specific vs. serum levels for predictive value

  • Integration with other clinical and molecular factors for comprehensive prognostic models

What are the key unresolved questions about LAPTM4B's molecular mechanisms?

Several critical aspects of LAPTM4B's molecular mechanisms remain to be fully elucidated:

  • Precise mechanism of GARP regulation: While LAPTM4B is known to interact with GARP and reduce its surface levels, the exact molecular mechanisms (e.g., enhanced endocytosis, reduced transport to the membrane, or increased degradation) require further investigation .

  • GARP-independent functions: LAPTM4B affects TGF-β1 secretion even in the absence of GARP, suggesting additional regulatory mechanisms that remain undefined .

  • Isoform-specific functions: The functional differences between LAPTM4B isoforms (iso24 and iso20) in different cellular contexts and disease states warrant detailed study .

  • Autophagy regulation mechanisms: While LAPTM4B is critical for autophagic maturation, the specific molecular interactions and signaling events involved in this process need clarification .

  • Cancer-type specific mechanisms: How LAPTM4B contributes to the pathogenesis of different cancer types may involve distinct molecular pathways and interactions .

  • Physiological role in normal cells: Most studies have focused on LAPTM4B in cancer or immune cells, leaving its normal physiological functions in other cell types largely unexplored.

  • Regulation of LAPTM4B expression: The transcriptional and post-transcriptional mechanisms controlling LAPTM4B expression levels remain poorly understood.

How might LAPTM4B be targeted therapeutically, and what methodologies would be needed to develop such approaches?

The development of therapeutic strategies targeting LAPTM4B would require several methodological approaches:

  • Structure-based drug design:

    • Determination of LAPTM4B's three-dimensional structure through X-ray crystallography or cryo-EM

    • In silico screening for small molecules that could disrupt key protein-protein interactions (e.g., LAPTM4B-GARP binding)

    • Rational design of peptide inhibitors based on interaction interfaces

  • Functional inhibition strategies:

    • Development of neutralizing antibodies against LAPTM4B's extracellular domains

    • Design of aptamers that specifically bind and inhibit LAPTM4B

    • Creation of dominant-negative LAPTM4B variants for potential gene therapy approaches

  • Expression modulation approaches:

    • Identification of transcriptional regulators of LAPTM4B for indirect targeting

    • Development of antisense oligonucleotides or siRNA delivery systems for LAPTM4B knockdown

    • Screening for compounds that reduce LAPTM4B protein stability

  • Combination therapy strategies:

    • Investigation of synergistic effects between LAPTM4B inhibition and current cancer therapies

    • Exploration of dual targeting of LAPTM4B and its downstream effectors (e.g., PI3K/AKT pathway)

  • Cancer-specific delivery methods:

    • Development of nanoparticle-based delivery systems for LAPTM4B inhibitors

    • Creation of cancer-targeting antibody-drug conjugates incorporating LAPTM4B modulators

These therapeutic approaches would need to be tested in relevant preclinical models before clinical translation, with careful attention to potential on-target and off-target effects given LAPTM4B's role in normal cellular processes.

What are the most pressing research priorities for advancing our understanding of LAPTM4B?

The most critical research priorities for LAPTM4B include:

  • Comprehensive characterization of structure-function relationships: Determining how specific domains and motifs of LAPTM4B contribute to its various functions in different cellular contexts.

  • Elucidation of the complete LAPTM4B interactome: Identifying the full range of proteins that interact with LAPTM4B beyond known partners like GARP.

  • Investigation of tissue-specific functions: Understanding how LAPTM4B's role varies across different tissues and cell types, particularly in non-cancerous settings.

  • Clarification of roles in immune regulation: Further exploring how LAPTM4B influences immune responses beyond its effects on Tregs and TGF-β1 production.

  • Validation as a biomarker: Large-scale, multicenter studies to validate LAPTM4B's utility as a diagnostic, prognostic, and predictive biomarker across different cancer types.

  • Development of standardized detection methods: Creating robust, reproducible assays for LAPTM4B quantification in various biological specimens.

  • Investigation of genetic variations: Examining how LAPTM4B polymorphisms contribute to cancer susceptibility and prognosis across diverse populations.

What are the major technical and conceptual challenges in LAPTM4B research?

Researchers face several significant challenges when studying LAPTM4B:

  • Membrane protein analysis difficulties: As a transmembrane protein, LAPTM4B presents technical challenges for structural studies, purification, and functional assays.

  • Isoform complexity: The existence of multiple isoforms complicates experimental design and interpretation, requiring isoform-specific tools and approaches.

  • Context-dependent functions: LAPTM4B appears to have different roles depending on cell type and physiological state, necessitating careful consideration of experimental systems.

  • Overlap with other LAPTM family members: Potential functional redundancy or interaction with other LAPTM family proteins may complicate phenotypic analysis of LAPTM4B manipulation.

  • Clinical sample heterogeneity: Variability in patient samples and detection methods challenges the standardization of LAPTM4B as a biomarker.

  • Causality vs. correlation: Distinguishing whether LAPTM4B alterations are drivers or consequences of disease processes requires sophisticated experimental approaches.

  • Therapeutic targeting complexity: As a protein involved in multiple cellular processes, selective targeting of LAPTM4B's pathological functions while preserving physiological roles presents a significant challenge.

  • Integration with broader cellular networks: Understanding how LAPTM4B functions within the context of complex cellular signaling networks requires systems biology approaches and computational modeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.