Recombinant Human Lysosomal-associated transmembrane protein 5 (LAPTM5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. Should you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
LAPTM5; KIAA0085; Lysosomal-associated transmembrane protein 5; Lysosomal-associated multitransmembrane protein 5; Retinoic acid-inducible E3 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LAPTM5
Target Protein Sequence
MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE EALSLPSKTPEGGPAPPPYSEV
Uniprot No.

Target Background

Function
LAPTM5 may play a specific functional role during embryogenesis and in adult hematopoietic cells.
Gene References Into Functions
  1. Findings suggest that LAPTM5 inactivation might contribute to tumorigenesis in a subset of human cancers PMID: 27058622
  2. Our results indicate that decreased LAPTM5 inhibited proliferation and viability, and induced G0/G1 cell cycle arrest potentially through ERK1/2 and p38 deactivation in BCa cells PMID: 27922670
  3. Insufficient LAPTM5 expression may contribute to the pathogenesis of systemic lupus erythematosus (SLE) and potentially influence disease severity. However, our analysis showed no significant association of LAPTM5 polymorphisms with SLE susceptibility in a Chinese population. PMID: 25998573
  4. The interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments suggest that LAPTM5 might influence CD1e's role in lipid antigen presentation. PMID: 22880058
  5. LAPTM5 is a substrate of ITCH-mediated degradation, and its protein level is negatively regulated by ITCH PMID: 22009753
  6. LAPTM5-mediated programmed cell death is strongly associated with the spontaneous regression of neuroblastomas PMID: 19787053
  7. LAPTM5 exhibits stage-specific expression during B cell differentiation and may be involved in B cell malignancies. PMID: 12527926
  8. Results suggest that loss of E3 gene expression might be a crucial event during the progression of human MM PMID: 12886255

Show More

Hide All

Database Links

HGNC: 29612

OMIM: 601476

KEGG: hsa:7805

STRING: 9606.ENSP00000294507

UniGene: Hs.371021

Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney.

Q&A

What is the basic function of LAPTM5 in immune cells?

LAPTM5 functions vary significantly across different immune cell types. In macrophages, LAPTM5 acts as a positive regulator of NF-κB and MAPK signaling pathways, facilitating proinflammatory cytokine secretion in response to pattern recognition receptors and TNF receptor stimulation . Conversely, in T and B cells, LAPTM5 negatively regulates receptor signaling by mediating receptor degradation, thus limiting immune activation . This apparent contradiction highlights LAPTM5's cell type-specific roles in immune modulation, making it a fascinating target for differential immune regulation studies.

How is LAPTM5 expression regulated during cellular activation?

LAPTM5 protein levels demonstrate dynamic regulation during cellular activation. In macrophages, LPS stimulation causes a rapid and dramatic decrease in LAPTM5 protein levels, with significant reduction observed within 1 hour and near-complete disappearance by 6 hours post-stimulation . This regulation occurs primarily at the post-transcriptional level, as LAPTM5 mRNA remains largely unchanged during stimulation . Similarly, in neuronal cells during cerebral ischemia-reperfusion injury, LAPTM5 expression is dramatically decreased both in vivo and in vitro . These findings suggest that LAPTM5 degradation may represent a regulatory mechanism during cellular activation and stress responses.

What structural domains are critical for LAPTM5 function?

LAPTM5 contains several key functional domains that mediate its interactions and cellular localization:

  • Three polyproline-tyrosine (PY) motifs (L/PPxY)

  • One ubiquitin interacting motif (UIM)

Mutation studies have revealed that different domains serve specific functions. The PY2 and UIM domains are required for LAPTM5's interaction with ASK1 . The third PY motif (PY3) appears most important for interaction with Nedd4, which along with GGA3 (which binds to the UIM domain) facilitates LAPTM5 translocation from the Golgi to lysosomes . Additionally, mutations in PY2 or PY3 eliminate LAPTM5's ability to downregulate T cell antigen receptor (TCR), while UIM mutation reduces its capacity to degrade TCR .

How does LAPTM5 regulate the ASK1-JNK/p38 pathway in neuronal cells?

LAPTM5 directly interacts with ASK1 through its PY2 and UIM domains, as confirmed by co-immunoprecipitation and GST pull-down assays . This interaction specifically requires the N-terminus of ASK1 (amino acids 1-678) . Functionally, LAPTM5 binding decreases ASK1 N-terminal dimerization, which subsequently reduces activation of downstream JNK/p38 signaling . In neuronal cells undergoing ischemia-reperfusion injury, LAPTM5 deficiency exacerbates inflammatory responses and apoptosis by enhancing ASK1-JNK/p38 pathway activation . This mechanism positions LAPTM5 as a potential neuroprotective factor during cerebral ischemia-reperfusion injury.

What is the role of LAPTM5 in TNF-induced signaling in macrophages?

In macrophages, LAPTM5 functions as a positive regulator of TNF signaling. LAPTM5-deficient macrophages exhibit reduced activation of NF-κB and MAPK signaling pathways following TNF receptor stimulation . Mechanistically, TNF stimulation of LAPTM5-deficient macrophages leads to reduced ubiquitination of RIP1 (receptor-interacting protein 1), suggesting LAPTM5 acts at the receptor-proximate level . Additionally, macrophages from LAPTM5-/- mice display up-regulated levels of A20, a ubiquitin-editing enzyme responsible for deubiquitination of RIP1 and subsequent termination of NF-κB activation . This suggests LAPTM5 may negatively regulate A20 levels, thereby promoting sustained inflammatory signaling.

How does LAPTM5 modulate BMP signaling in cancer cells?

LAPTM5 suppresses BMP signaling in renal cell carcinoma (RCC), particularly in the context of lung metastasis. High LAPTM5 expression in RCC cells renders them less responsive to BMP4-induced Smad 1/5/8 phosphorylation . This mechanism enables LAPTM5-expressing cancer cells to overcome the inhibitory effect of lung-derived BMP anti-metastatic signals on cancer stem cell traits . Specifically, LAPTM5 enhances the expression of stemness genes (Nanog, Oct4, Sox2) in RCC cells by counteracting BMP4-mediated suppression . This function appears to be crucial for RCC cells to initiate and maintain metastatic growth in the lung microenvironment.

What is the significance of LAPTM5 in cerebral ischemia-reperfusion injury?

LAPTM5 plays a protective role in cerebral ischemia-reperfusion (I/R) injury. LAPTM5 knockout mice subjected to transient middle cerebral artery occlusion (tMCAO) exhibit larger infarct sizes and more severe neurological dysfunction compared to control mice . Additionally, inflammatory responses and apoptosis are exacerbated in LAPTM5-deficient conditions . In vitro studies confirm that neuronal inflammation and apoptosis are aggravated by LAPTM5 knockdown but mitigated by its overexpression . Mechanistically, LAPTM5 exerts its protective effects by inhibiting the ASK1-JNK/p38 pathway through direct interaction with ASK1, suggesting LAPTM5 could be a potential therapeutic target for stroke treatment.

What role does LAPTM5 play in B cell tolerance and autoimmunity?

LAPTM5 mediates immature B cell apoptosis and contributes to B cell tolerance. BCR cross-linking in immature B cells activates a LAPTM5-WWP2-PTEN cascade that regulates apoptosis . This pathway represents an important mechanism for eliminating autoreactive developing B cells, thereby preventing autoantibody production . The involvement of LAPTM5 in this process highlights its significance in immune tolerance and suggests potential implications for autoimmune disease research.

What are the optimal experimental systems for studying LAPTM5 function?

Based on current research, several experimental systems have proven effective for investigating LAPTM5 function:

  • Cellular models:

    • RAW264.7 macrophage cell line for inflammatory signaling studies

    • Primary bone marrow-derived macrophages (BMDMs) for physiological relevance

    • Primary neurons for cerebral ischemia studies (OGD/R model)

    • Renal cancer cell lines (Renca, 786-O) for metastasis studies

  • Animal models:

    • LAPTM5 knockout mice for in vivo loss-of-function studies

    • Transient middle cerebral artery occlusion (tMCAO) for cerebral ischemia-reperfusion injury

    • Tail vein injection models for lung metastasis studies

  • Molecular tools:

    • Domain-specific mutants (mUIM, mPY1, mPY2, mPY3, mPY1-3) for structure-function analysis

    • Doxycycline-inducible (Tet-on) systems for temporal control of LAPTM5 expression

    • shRNA-mediated knockdown for partial loss-of-function studies

What methods are effective for detecting LAPTM5 protein-protein interactions?

Several complementary approaches have been successfully employed to identify and characterize LAPTM5 interactions:

  • Co-immunoprecipitation (co-IP): Effective for demonstrating interactions in cellular contexts, typically using tagged constructs (e.g., Flag-tagged LAPTM5 and HA-tagged interacting proteins) .

  • GST pull-down assays: Valuable for confirming direct protein-protein interactions and identifying interaction domains .

  • Molecular mapping with truncation/deletion mutants: Essential for identifying specific domains responsible for interactions:

    • ASK1 truncation mutants identified the N-terminus (amino acids 1-678) as necessary for LAPTM5 binding

    • LAPTM5 domain-specific mutants (mUIM, mPY1, mPY2, mPY3, mPY1-3) revealed PY2 and UIM domains as critical for ASK1 interaction

  • Functional validation: Changes in downstream signaling (e.g., ASK1 N-terminal dimerization, JNK/p38 phosphorylation) confirm biological relevance of interactions .

How can researchers address the contradictory roles of LAPTM5 across different cell types?

LAPTM5 exhibits opposite functions in different cell types: positive regulation of inflammatory signaling in macrophages versus negative regulation in T and B cells. To address these contradictions, researchers should consider:

  • Cell type-specific experimental design:

    • Use matched cell types for direct comparisons

    • Employ tissue-specific or inducible knockout models to isolate effects

  • Context-dependent signaling analysis:

    • Examine receptor-specific pathways (TLR, TNF-R, BCR, TCR)

    • Analyze temporal dynamics of LAPTM5 expression and localization

  • Comprehensive mechanistic investigation:

    • Identify cell type-specific interaction partners

    • Compare ubiquitination patterns and targets

    • Examine subcellular localization differences

  • Multi-omics approach:

    • Combine transcriptomics, proteomics, and interactomics

    • Use systems biology to model cell type-specific signaling networks

How might recombinant LAPTM5 be utilized for studying its structure-function relationships?

Recombinant LAPTM5 presents valuable opportunities for detailed structure-function analysis:

  • Domain-specific mutation studies: Creating recombinant LAPTM5 with targeted mutations in PY motifs or UIM domains allows precise mapping of functional regions. For instance, mutations in PY2 (Y239A) or UIM (Q232A, V235G, L236A) domains have revealed their necessity for ASK1 interaction .

  • Truncation analysis: Developing truncated LAPTM5 constructs can identify minimal functional domains required for specific protein interactions or cellular functions.

  • Cross-linking studies: Chemical cross-linking coupled with mass spectrometry using purified recombinant LAPTM5 can provide detailed information about interaction interfaces.

  • Subcellular targeting: Creating chimeric recombinant LAPTM5 with altered localization signals can help determine the importance of lysosomal localization for various functions.

  • Structural biology approaches: While challenging for multi-spanning membrane proteins, cryo-EM or X-ray crystallography of recombinant LAPTM5 in complex with interaction partners would provide valuable structural insights.

What are the emerging therapeutic implications of LAPTM5 research?

Based on current research, several therapeutic applications are emerging:

  • Neuroprotection in stroke: LAPTM5's protective role against cerebral I/R injury through ASK1-JNK/p38 pathway inhibition suggests potential for therapeutic targeting in stroke treatment .

  • Cancer metastasis: Given LAPTM5's role in promoting lung-specific metastasis in RCC, inhibiting LAPTM5 or its downstream pathways could potentially reduce metastatic spread .

  • Inflammatory regulation: The contradictory roles of LAPTM5 in different immune cells offer opportunities for cell type-specific modulation of inflammatory responses .

  • Autoimmunity: LAPTM5's involvement in B cell tolerance suggests potential therapeutic applications in autoimmune disorders .

What cutting-edge technologies could advance LAPTM5 research?

Several emerging technologies could significantly enhance LAPTM5 research:

  • CRISPR-Cas9 domain editing: Precise modification of specific LAPTM5 domains in endogenous contexts to avoid overexpression artifacts.

  • Optogenetic control: Light-controlled activation/inactivation of LAPTM5 or its interaction partners for temporal precision in functional studies.

  • Proximity labeling proteomics: BioID or APEX2-based approaches to identify the complete LAPTM5 interactome in different cellular compartments and conditions.

  • Single-cell multi-omics: Analyzing LAPTM5 expression, localization, and function at single-cell resolution to capture heterogeneity.

  • Advanced microscopy techniques: Super-resolution microscopy and live-cell imaging to visualize LAPTM5 trafficking and interactions in real-time.

  • Organ-on-chip models: Studying LAPTM5 function in complex multicellular environments that better recapitulate in vivo conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.