Recombinant Human Magnesium transporter MRS2 homolog, mitochondrial (MRS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2; HPT; MRS2L; Magnesium transporter MRS2 homolog, mitochondrial; MRS2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-443
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MRS2
Target Protein Sequence
RAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQ ELGLQARDLRFQHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPS QLSGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRS KLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHA EEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSL SLFGLMGVAFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMA SLPKKTLLADRSMELKNSLRLDGLGSGRSILTNR
Uniprot No.

Target Background

Function
A mitochondrial magnesium transporter mediating magnesium influx into the mitochondrial matrix. It is essential for the normal expression of mitochondrial respiratory complex I subunits.
Gene References Into Functions
  1. MRS2-mediated mitochondrial Mg2+ regulation is crucial for cellular energy levels and cell viability by modulating mitochondrial Mg2+ levels in response to physiological stimuli. PMID: 27458051
  2. hMrs2 is the primary transporter for mitochondrial Mg2+ uptake; its expression is vital for maintaining respiratory complex I and cell viability. PMID: 18384665
  3. Increased hsaMrs2p expression downregulates p27 and upregulates cyclin D1 in gastric cancer. PMID: 19242098
  4. Multidrug resistance is associated with the MRS2 mitochondrial magnesium channel. PMID: 19270501
Database Links

HGNC: 13785

KEGG: hsa:57380

STRING: 9606.ENSP00000367637

UniGene: Hs.658612

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and cellular localization of human MRS2?

Human Mitochondrial RNA Splicing 2 protein (MRS2) is a magnesium transporter located in the inner mitochondrial membrane that mediates the influx of Mg²⁺ into the mitochondrial matrix . Cryo-electron microscopy (cryo-EM) studies have revealed that human MRS2 forms a homo-pentameric channel with a funnel-shaped structure .

The full-length human MRS2 protein consists of 443 amino acids with an N-terminal mitochondrial targeting peptide (MTP) that is cleaved upon import into mitochondria . Experimental N-terminal sequencing of purified human MRS2 has shown that the first amino acid detected is residue 71, starting with threonine, indicating this is where the mature protein begins after cleavage of the MTP . This finding contradicts earlier predictions, including the Uniprot entry (Q9HD23) which suggested cleavage at residue 50 .

Confocal microscopy studies have confirmed that full-length MRS2 conjugated with GFP localizes to mitochondria, while truncated MRS2(71-443)-GFP cannot be imported into mitochondria and largely localizes to the endoplasmic reticulum . For structural studies, researchers have successfully used a construct consisting of amino acids 62-431, where unstructured N- and C-terminal portions were removed based on AlphaFold predictions .

How does MRS2 function as an ion channel?

MRS2 functions as a Ca²⁺-regulated, nonselective cation channel permeable to Mg²⁺, Ca²⁺, Na⁺, and K⁺, which differs significantly from its prokaryotic ortholog CorA that operates as a Mg²⁺-gated Mg²⁺ channel . Electrophysiological analyses have demonstrated these unique properties of MRS2 .

A distinctive feature of MRS2 is a conserved arginine ring (R332) within the pore that restricts cation movements, preventing the channel from collapsing the proton motive force that drives mitochondrial ATP synthesis . The R332S substitution in MRS2 results in larger Mg²⁺ currents, suggesting this residue plays a key role in channel gating . Additionally, researchers have identified M336 as another major gating residue .

MRS2 contains unique Mg²⁺ binding sites that differ from those in CorA. One such site (site 3) is generated by an acidic pocket at the inter-subunit interface, constituted by E138, E243, and D247 from one subunit and E312 from an adjacent subunit . Unlike CorA, high extracellular Mg²⁺ does not cause inactivation of MRS2, indicating distinct regulatory mechanisms .

What experimental models are used to study MRS2 function?

Several experimental models and techniques have been employed to study MRS2 function:

  • Cell Lines: Human cell lines such as Expi293F cells for protein expression and localization studies , HeLa cells for functional analyses of Mg²⁺ uptake, cell migration, and apoptosis resistance , and gastric cancer cell lines for studying MRS2's role in multidrug resistance .

  • Xenopus Oocyte Expression System: Two-electrode voltage-clamp (TEVC) experiments in Xenopus oocytes have been used to characterize ion permeation and regulatory properties of MRS2 .

  • Yeast Expression Systems: Pichia pastoris has been used for expressing MRS2 for structural studies .

  • Protein Engineering Approaches: Researchers have employed fusion strategies, such as attaching thermostabilized BRIL protein to the C-terminal end of MRS2 to enhance expression and stability for structural studies .

  • Mutagenesis Studies: Site-directed mutagenesis of key residues (R332S, D216Q) to study gating mechanisms and Mg²⁺ sensing properties .

  • Cellular Assays: Divalent ion uptake assays, cell migration assays, and apoptosis resistance assays to evaluate the functional implications of MRS2 and its mutants .

What methods are used for recombinant expression and purification of human MRS2?

For successful recombinant expression and purification of human MRS2, researchers have employed the following strategies:

  • Construct Optimization: Truncated constructs removing unstructured N- and C-terminal portions (amino acids 62-431) have shown improved expression compared to full-length protein .

  • Fusion Protein Strategy: Attaching thermostabilized BRIL protein to the C-terminal end of MRS2 (MRS2 EM) enhanced expression and stability, making it suitable for structural studies .

  • Expression Systems: Yeast Pichia pastoris has proven effective for producing MRS2 for structural studies , while mammalian expression systems like Expi293F cells have been used for cellular localization studies .

  • Purification Protocol: Successful purification has been achieved using affinity chromatography followed by size-exclusion chromatography in the presence of Mg²⁺ . Native-PAGE analysis of purified MRS2 shows a major band between the native marker at 242 kDa and 480 kDa, confirming oligomeric assembly .

  • Quality Control: Negative-staining EM followed by 2D classification of MRS2 particles has been used to verify the funnel-shaped structure resembling that observed in CorA before proceeding to cryo-EM studies .

What are the key structural differences between human MRS2 and prokaryotic CorA?

Despite both being magnesium channels with homopentameric architecture, human MRS2 and prokaryotic CorA exhibit several significant structural differences:

  • α/β Domain Structure: The α/β domain in human MRS2 contains a six-stranded β-sheet with two α-helices, in contrast to CorA's seven-stranded β-sheet with four α-helices . This structural divergence results in different topology and assembly interfaces.

  • Mg²⁺ Binding Sites: MRS2 has evolved unique interfacial Mg²⁺-binding sites that differ from those in TmCorA. In particular, MRS2 features a distinctive binding site (site 3) at the inter-subunit interface formed by E138, E243, and D247 from one subunit and E312 from an adjacent subunit .

  • Inter-subunit Packing: MRS2 exhibits reduced inter-subunit packing interactions due to its smaller α/β domain, suggesting a distinct channel regulation mechanism compared to CorA .

  • Gating Mechanism: While Mg²⁺ occupancy at the α/β domain inter-subunit interface dictates conformational changes and channel closure in CorA, MRS2 appears to employ a different gating strategy . The arginine ring (R332) in MRS2 plays a crucial role in restricting cation movement, serving as a major gating element .

  • Ion Selectivity: Unlike CorA, which is primarily a Mg²⁺ channel, MRS2 exhibits broader ion selectivity, conducting Ca²⁺, K⁺, and Na⁺ in addition to Mg²⁺ .

These structural and functional differences highlight the evolutionary divergence between mammalian MRS2 and its prokaryotic counterpart, reflecting adaptations to the specialized environment of the mitochondrial inner membrane.

How do mutations in MRS2 affect its function and relate to disease?

Several key mutations in MRS2 have been studied for their functional effects and potential disease implications:

  • R332S Mutation: This substitution results in larger Mg²⁺ currents compared to wild-type MRS2, suggesting R332 acts as a major gating residue restricting ion flow . The R332S mutant demonstrates enhanced conductance not only for Mg²⁺ but also for Ca²⁺, K⁺, and Na⁺ .

  • D216Q Mutation: This missense variation has been identified in association with malignant melanoma . Biophysical and functional studies have shown that D216Q:

    • Abrogates Mg²⁺-binding and associated conformational changes, including increased α-helicity, stability, and monomerization

    • Prevents the weakening of matrix domain interactions typically observed in wild-type MRS2 in the presence of Mg²⁺

    • Enhances Mg²⁺ uptake, cell migration, and resistance to apoptosis in HeLa cells

    • Robustly potentiates cancer phenotypes compared to wild-type MRS2

  • Loss of Function Mutations: Knockdown of MRS2 in human cells leads to reduced uptake of Mg²⁺ into mitochondria, loss of respiratory complex I, disruption of mitochondrial metabolism, and cell death . A loss of function mutation disrupting MRS2 has been associated with demyelination syndrome in rats .

These findings collectively demonstrate that MRS2 mutations can impact mitochondrial Mg²⁺ homeostasis, cell survival, and potentially contribute to cancer progression, highlighting the clinical relevance of MRS2 research.

What techniques are most effective for measuring MRS2-mediated ion transport?

Researchers have employed several complementary techniques to measure MRS2-mediated ion transport:

  • Two-Electrode Voltage-Clamp (TEVC): This electrophysiological approach in Xenopus oocytes has proven valuable for characterizing ion permeation properties and regulation of MRS2 . TEVC experiments with varying cations in perfusion solutions have demonstrated that MRS2 can conduct Mg²⁺, Ca²⁺, K⁺, and Na⁺ .

  • Cellular Divalent Ion Uptake Assays: These assays provide a means to measure ion transport in intact cells, allowing assessment of how mutations (such as R332S and D216Q) affect channel function .

  • Calcium Current Inactivation Analysis: These measurements have revealed that Ca²⁺ currents through MRS2 channels show rapid decay to a steady state of less than 5% of the peak level within 1 minute, whereas K⁺ and Na⁺ currents do not exhibit this behavior . This technique helps distinguish genuine MRS2-mediated currents from contaminating Ca²⁺-activated Cl⁻ currents.

  • Mg²⁺ Transport Recordings in Different Ionic Conditions: By manipulating the ionic composition of recording solutions, researchers have found that Mg²⁺ currents through wild-type MRS2 are not observed in solutions with >100 mM of Cl⁻, providing insight into the channel's ionic requirements .

  • Comparative Analysis with Known Channels: Comparing the electrophysiological properties of MRS2 with those of TmCorA helps validate findings and highlight functional distinctions between these related channels .

For optimal results, researchers should consider combining multiple techniques to comprehensively characterize the ion transport properties of MRS2 and its mutants.

What is the role of MRS2 in cancer progression and multidrug resistance?

MRS2 has been implicated in cancer progression and multidrug resistance through several mechanisms:

  • Upregulation in Multidrug-Resistant Cancer: Human MRS2 was identified as an upregulated gene in a multidrug-resistant (MDR) gastric cancer cell line compared to its parental cells by subtractive hybridization .

  • Modulation of Drug Resistance: MRS2 expression can positively regulate adriamycin resistance of SGC7901/ADR cells both in vitro and in vivo . Further studies showed that MRS2 increased the adriamycin-releasing index, suggesting an impact on drug efflux .

  • Inhibition of Apoptosis: Upregulation of MRS2 inhibits adriamycin-induced apoptosis, probably by suppressing Bax-induced cytochrome C release from mitochondria . HeLa cells overexpressing MRS2 show enhanced resistance to apoptosis .

  • Cell Cycle Regulation: MRS2 promotes cell growth, and decreased MRS2 expression results in significant inhibition of cell growth with G1 cell cycle arrest . Enhanced MRS2 expression leads to downregulation of p27 and upregulation of cyclin D1 .

  • Enhanced Cell Migration: HeLa cells overexpressing MRS2 exhibit enhanced cell migration, a key feature of metastatic cancer cells .

  • D216Q Mutation Effects: The D216Q mutation, associated with malignant melanoma, robustly potentiates cancer phenotypes including Mg²⁺ uptake, cell migration, and resistance to apoptosis compared to wild-type MRS2 .

These findings suggest that MRS2 may serve as a promising target for multidrug resistance reversal therapy and potentially for cancer treatment more broadly .

How does MRS2 contribute to mitochondrial metabolism and cell survival?

MRS2 plays a crucial role in mitochondrial metabolism and cell survival through its regulation of mitochondrial Mg²⁺ homeostasis:

  • Essential for Mitochondrial Physiology: Mg²⁺ ions play an essential role in mitochondrial physiology, directly regulating protein and ATP synthesis and various metabolic pathways . As the main Mg²⁺ channel in the inner mitochondrial membrane, MRS2 is critical for maintaining appropriate Mg²⁺ levels in the mitochondrial matrix .

  • Impact on Respiratory Complex I: Knockdown of MRS2 in human cells leads to loss of respiratory complex I, a key component of the electron transport chain essential for oxidative phosphorylation .

  • Metabolic Reprogramming: Studies in mice have shown that knockout of MRS2 causes reprogramming of metabolism, including upregulation of thermogenesis, oxidative phosphorylation, and fatty acid catabolism via HIF1α transcriptional regulation .

  • Lactate-Mediated Mg²⁺ Uptake: Recent studies in mice demonstrate that MRS2 is required for lactate-mediated Mg²⁺ uptake in mitochondria, suggesting a link between cellular energy metabolism and MRS2 function .

  • Prevention of Proton Motive Force Collapse: The arginine ring (R332) within the MRS2 pore restricts cation movements, preventing the channel from collapsing the proton motive force that drives mitochondrial ATP synthesis .

  • Matrix Mg²⁺ Overload Prevention: The MRS2 matrix domain acts as a critical Mg²⁺ sensor that undergoes conformational and assembly changes upon Mg²⁺ interactions dependent on D216, tempering matrix Mg²⁺ overload which could otherwise disrupt mitochondrial function .

  • Cell Death Regulation: Disruption of MRS2 function leads to cell death, highlighting its essential role in cellular viability . Conversely, enhanced MRS2 activity can confer resistance to apoptosis, as seen in cancer cells .

Understanding these mechanisms provides insight into the fundamental role of MRS2 in cellular energy metabolism and may inform therapeutic strategies targeting mitochondrial function in various diseases.

What are the current challenges in studying human MRS2 and future research directions?

Several challenges and future research directions in the study of human MRS2 can be identified:

  • Protein Expression and Purification: Heterologous expression of full-length human MRS2 has been insufficient for structural studies, necessitating truncated constructs and fusion strategies . Further optimization of expression systems and purification protocols would facilitate more extensive structural and functional analyses.

  • Physiological Regulation: While the basic ion transport properties of MRS2 have been characterized, the physiological signals and mechanisms that regulate its activity in vivo remain to be fully elucidated. Investigation of potential interactions with other mitochondrial proteins and metabolites would provide insight into its regulation.

  • Tissue-Specific Functions: The role of MRS2 may vary across different tissues with distinct metabolic demands. Systematic studies comparing MRS2 function in various cell types and tissues would enhance our understanding of its physiological significance.

  • Therapeutic Targeting: Given its roles in cancer progression and multidrug resistance, development of specific MRS2 modulators could provide novel therapeutic approaches. Structure-based drug design targeting the unique features of MRS2 could yield selective inhibitors or activators.

  • Disease Associations: While links to cancer have been established, the potential involvement of MRS2 in other diseases, particularly those involving mitochondrial dysfunction, warrants investigation. Genetic studies could identify additional disease-associated mutations.

  • Interaction with Other Ion Channels: The interplay between MRS2 and other mitochondrial ion channels/transporters remains largely unexplored. Investigating these relationships would provide a more comprehensive understanding of mitochondrial ion homeostasis.

  • Physiological Significance of Broad Ion Selectivity: Unlike the Mg²⁺-selective CorA, MRS2 conducts multiple cations. The biological significance of this broader selectivity and its potential role in mitochondrial physiology beyond Mg²⁺ homeostasis represents an important area for future research.

  • Conformational Dynamics: More detailed analysis of MRS2's conformational changes during ion transport and regulation would enhance our mechanistic understanding. Techniques such as single-molecule FRET could provide valuable insights into these dynamic processes.

Addressing these challenges will advance our understanding of MRS2's fundamental biology and potentially reveal new therapeutic opportunities targeting mitochondrial magnesium transport.

What are the key considerations for designing mutations to study MRS2 function?

When designing mutations to study MRS2 function, researchers should consider the following:

How can researchers effectively measure mitochondrial magnesium levels when studying MRS2?

Measuring mitochondrial magnesium levels when studying MRS2 requires specialized techniques to distinguish mitochondrial from cytosolic pools:

  • Fluorescent Magnesium Indicators:

    • Mag-Fura-2 AM: This ratiometric dye can be used with mitochondrial co-localization markers to assess relative changes in mitochondrial Mg²⁺ .

    • Mag-Fluo-4: Another fluorescent indicator with high sensitivity for Mg²⁺ that can be targeted to mitochondria.

  • Mitochondria-Targeted Mg²⁺ Sensors:

    • MagMito: A genetically encoded, fluorescent protein-based Mg²⁺ sensor specifically targeted to mitochondria provides superior specificity compared to chemical indicators.

    • Mito-MagGreen: Another mitochondria-targeted fluorescent sensor that allows real-time monitoring of mitochondrial Mg²⁺ levels.

  • Isolated Mitochondria Assays:

    • Rapid isolation of mitochondria followed by atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS) provides quantitative measurements of total mitochondrial Mg²⁺ content.

    • Mg²⁺-selective electrodes can be used with isolated mitochondria to measure Mg²⁺ flux in response to various stimuli.

  • Live-Cell Imaging Approaches:

    • Confocal microscopy with mitochondria-targeted Mg²⁺ indicators allows spatial and temporal resolution of Mg²⁺ dynamics within individual mitochondria in intact cells.

    • Multi-parametric imaging combining Mg²⁺ indicators with probes for mitochondrial membrane potential or calcium can reveal relationships between these parameters.

  • Patch-Clamp Electrophysiology of Mitoplasts:

    • Direct measurement of MRS2-mediated currents in mitoplasts (mitochondria with the outer membrane removed) provides the most direct assessment of channel function, though technically challenging.

  • Permeabilized Cell Systems:

    • Selective permeabilization of the plasma membrane while maintaining mitochondrial integrity allows control of the cytosolic environment while monitoring mitochondrial Mg²⁺ uptake.

  • Considerations for Data Interpretation:

    • Calibration is essential for quantitative measurements, typically using ionophores to equilibrate Mg²⁺ across membranes.

    • Controls with MRS2 knockdown/knockout cells help validate that observed changes are specifically related to MRS2 function.

    • Mitochondrial heterogeneity within cells should be considered when interpreting imaging data.

These approaches can be combined to provide comprehensive analysis of MRS2-mediated Mg²⁺ transport and its impact on mitochondrial function.

What are the optimal conditions for structural studies of human MRS2?

Based on successful structural studies described in the literature, the following conditions have proven optimal for structural analysis of human MRS2:

  • Construct Design:

    • Truncated constructs removing unstructured N- and C-terminal portions (amino acids 62-431) show improved properties for structural studies compared to full-length protein .

    • Fusion with thermostabilized BRIL protein at the C-terminal end (MRS2 EM) significantly enhances expression and stability .

    • Removal of the mitochondrial targeting peptide (residues 1-70) is essential as this region is cleaved in the mature protein and may interfere with proper folding in recombinant systems .

  • Expression System:

    • Yeast Pichia pastoris has proven effective for producing MRS2 for structural studies, yielding protein with excellent biochemical properties .

    • The choice of expression system should be guided by the requirement for eukaryotic post-translational modifications and proper membrane protein folding.

  • Purification Conditions:

    • Affinity chromatography followed by size-exclusion chromatography in the presence of Mg²⁺ yields homogeneous protein suitable for structural studies .

    • Inclusion of appropriate detergents or lipid nanodiscs is critical for maintaining the native conformation of this membrane protein.

  • Sample Validation:

    • Negative-staining EM followed by 2D classification provides a valuable quality check before proceeding to cryo-EM, confirming the expected funnel-shaped pentameric structure .

    • Native-PAGE analysis helps verify the oligomeric state, with MRS2 appearing as a band between 242 kDa and 480 kDa markers .

  • Cryo-EM Conditions:

    • Various ionic conditions have been successfully employed for structure determination, including:

      • 10 mM EDTA to chelate Mg²⁺ (Mg²⁺-free condition)

      • Presence of Mg²⁺ at physiologically relevant concentrations

      • Ca²⁺-containing conditions to understand Ca²⁺ binding and regulation

    • These different conditions have revealed structures at resolutions of 2.8 Å (with Mg²⁺) and 3.3 Å (without Mg²⁺) .

  • Complementary Approaches:

    • Integrating structural data with functional assays, particularly electrophysiology of the same constructs used for structural studies, provides valuable validation and functional context .

    • Computational approaches such as molecular dynamics simulations can complement experimental structures by providing insights into dynamic aspects of channel function.

These optimized conditions have enabled successful determination of human MRS2 structures that provide significant insights into its function and regulation.

How is MRS2 involved in cancer progression and what are the therapeutic implications?

MRS2 involvement in cancer progression operates through several mechanisms with important therapeutic implications:

  • Multidrug Resistance Promotion:

    • MRS2 was identified as an upregulated gene in multidrug-resistant gastric cancer cells .

    • It positively regulates adriamycin resistance both in vitro and in vivo, increasing the adriamycin-releasing index .

    • Therapeutic implication: MRS2 inhibition could potentially reverse drug resistance in cancer, enhancing the efficacy of conventional chemotherapeutics.

  • Apoptosis Resistance:

    • Upregulation of MRS2 inhibits adriamycin-induced apoptosis by suppressing Bax-induced cytochrome C release from mitochondria .

    • HeLa cells overexpressing MRS2 show enhanced resistance to apoptosis .

    • Therapeutic implication: Targeting MRS2 might sensitize cancer cells to apoptosis-inducing therapies, particularly those targeting mitochondrial pathways.

  • Cell Cycle Regulation:

    • MRS2 promotes cell growth through downregulation of p27 and upregulation of cyclin D1 .

    • Decreased MRS2 expression results in G1 cell cycle arrest .

    • Therapeutic implication: MRS2 inhibition could potentially slow cancer cell proliferation by inducing cell cycle arrest.

  • Enhanced Cell Migration:

    • HeLa cells overexpressing MRS2 exhibit enhanced cell migration, a key feature of metastatic cancer cells .

    • Therapeutic implication: Targeting MRS2 might reduce metastatic potential in aggressive cancers.

  • D216Q Mutation Effects:

    • The D216Q mutation, associated with malignant melanoma, robustly potentiates cancer phenotypes .

    • This mutation abrogates Mg²⁺-binding and associated conformational changes, leading to matrix Mg²⁺ overload .

    • Therapeutic implication: Patients with D216Q mutations might benefit from personalized approaches targeting altered MRS2 function.

  • Therapeutic Approaches:

    • Direct inhibitors of MRS2 channel activity could be developed based on structural insights from cryo-EM studies .

    • RNA interference or antisense oligonucleotides targeting MRS2 expression might be effective in cancers dependent on elevated MRS2 levels .

    • Compounds that restore normal Mg²⁺ sensing in mutant MRS2 (such as D216Q) could represent a novel therapeutic strategy for specific cancer subtypes .

    • Combination therapies targeting MRS2 alongside conventional chemotherapeutics might enhance efficacy and reduce drug resistance .

  • Biomarker Potential:

    • MRS2 expression levels or the presence of specific mutations like D216Q could serve as biomarkers to predict treatment response or guide therapy selection .

These findings collectively suggest that MRS2 represents a promising target for cancer therapy, particularly in contexts where drug resistance, enhanced migration, or apoptosis resistance contribute to poor treatment outcomes.

What is the relationship between mitochondrial magnesium homeostasis, MRS2 function, and neurodegenerative diseases?

While the search results don't directly address neurodegenerative diseases in detail, we can infer potential relationships based on what is known about MRS2 function and magnesium homeostasis:

  • Demyelination Disorders:

    • A loss of function mutation disrupting MRS2 has been associated with demyelination syndrome in rats . This suggests that proper MRS2 function is essential for myelin maintenance, which is relevant to multiple sclerosis and other demyelinating disorders.

    • Mitochondrial dysfunction is a recognized feature of demyelinating diseases, and MRS2's role in maintaining mitochondrial function through Mg²⁺ homeostasis may represent an underlying mechanism.

  • Mitochondrial Dysfunction in Neurodegeneration:

    • Knockdown of MRS2 leads to reduced Mg²⁺ uptake into mitochondria, loss of respiratory complex I, and disruption of mitochondrial metabolism . These features parallel mitochondrial abnormalities observed in neurodegenerative diseases such as Parkinson's disease and Alzheimer's disease.

    • The loss of respiratory complex I is particularly noteworthy as it is implicated in the pathogenesis of Parkinson's disease.

  • Magnesium Homeostasis and Neuroprotection:

    • Mg²⁺ is essential for protein stability, enzymatic activity, and ATP synthesis in mitochondria . In the context of neurons with high energy demands, disruption of mitochondrial Mg²⁺ homeostasis could compromise energy production and increase vulnerability to neurodegenerative processes.

    • Mg²⁺ deficiency has been linked to increased oxidative stress and excitotoxicity, both of which contribute to neurodegeneration.

  • Apoptosis Regulation:

    • MRS2 plays a role in regulating apoptosis by influencing cytochrome C release from mitochondria . Dysregulated apoptosis is a feature of many neurodegenerative diseases, suggesting that MRS2 dysfunction could contribute to inappropriate neuronal death.

  • Metabolic Reprogramming:

    • Knockout of MRS2 causes reprogramming of metabolism, including upregulation of thermogenesis, oxidative phosphorylation, and fatty acid catabolism via HIF1α transcriptional regulation . Such metabolic shifts might influence neuronal survival and function in neurodegenerative contexts.

  • Potential Therapeutic Implications:

    • Modulation of MRS2 function could represent a novel approach to address mitochondrial dysfunction in neurodegenerative diseases.

    • Enhancing mitochondrial Mg²⁺ uptake might protect against neurodegeneration by maintaining mitochondrial function and energy production.

    • Targeted delivery of Mg²⁺ to mitochondria could potentially bypass MRS2 dysfunction in cases where the channel is compromised.

While direct evidence linking MRS2 to human neurodegenerative diseases is limited in the provided search results, the critical role of MRS2 in mitochondrial function and its association with demyelination in animal models suggest it could be an important factor in neurodegeneration worthy of further investigation.

What purification protocol yields the highest quality recombinant human MRS2 for structural and functional studies?

Based on successful approaches documented in the literature, the following optimized purification protocol for recombinant human MRS2 can be recommended:

  • Construct Selection:

    • For structural studies: Use MRS2 EM construct (MRS2 core region amino acids 62-431 fused with thermostabilized BRIL protein at the C-terminus) .

    • For functional studies: Both full-length MRS2 (without the MTP) and MRS2 EM can be used, though MRS2 EM shows higher surface expression .

  • Expression System:

    • Yeast Pichia pastoris has proven effective for producing MRS2 for structural studies .

    • For smaller scale functional studies, mammalian expression in Expi293F cells can be used .

  • Detailed Purification Protocol:

    a. Cell Lysis and Membrane Preparation:

    • Harvest cells and lyse by mechanical disruption in buffer containing protease inhibitors.

    • Separate membranes by ultracentrifugation (typically 100,000g for 1 hour).

    • Solubilize membranes in buffer containing appropriate detergent (e.g., n-dodecyl-β-D-maltopyranoside or lauryl maltose neopentyl glycol).

    b. Affinity Chromatography:

    • For His-tagged constructs, use Ni-NTA affinity chromatography.

    • Include Mg²⁺ (typically 5-10 mM) in all buffers to maintain protein stability .

    • Wash extensively to remove non-specifically bound proteins.

    • Elute with imidazole gradient or step elution.

    c. Size-Exclusion Chromatography:

    • Further purify by gel filtration using a Superdex 200 or similar column.

    • Running buffer should contain Mg²⁺ and appropriate detergent at concentrations above the critical micelle concentration .

    • Collect fractions corresponding to the pentameric assembly (eluting between markers of 242 kDa and 480 kDa) .

    d. Quality Control Assessments:

    • Analyze purity by SDS-PAGE and oligomeric state by native-PAGE .

    • Verify proper folding by negative-stain electron microscopy and 2D classification to confirm the expected funnel-shaped pentameric structure .

    • For definitive identification, perform N-terminal sequencing to confirm the starting residue (typically residue 71 in mature human MRS2) .

  • Sample Preparation for Specific Applications:

    a. For Cryo-EM Studies:

    • Concentrate to 3-5 mg/ml using appropriate molecular weight cutoff concentrators.

    • Apply to glow-discharged grids and vitrify in liquid ethane.

    • For studies of different conformational states, prepare samples with various ionic conditions (e.g., with Mg²⁺, with Ca²⁺, or with EDTA to chelate divalent cations) .

    b. For Functional Studies:

    • For electrophysiology, reconstitute purified protein into proteoliposomes or utilize the protein directly in detergent for incorporation into artificial bilayers.

    • For biophysical studies of the soluble matrix domain, separate expression and purification of this domain may be preferable to avoid complications from the transmembrane region.

This protocol, based on successful approaches in the literature, should yield high-quality recombinant human MRS2 suitable for both structural and functional characterization.

What are the key experimental controls needed when studying MRS2 function in cell-based assays?

When designing cell-based assays to study MRS2 function, the following key experimental controls should be included:

  • Expression Verification Controls:

    • Western blotting to confirm MRS2 expression levels in wild-type, overexpression, knockdown, and mutant conditions .

    • Immunofluorescence or GFP-tagged MRS2 to verify proper mitochondrial localization . Compare with truncated MRS2(71-443)-GFP, which localizes primarily to the ER and serves as a mislocalization control .

  • Mitochondrial Integrity Controls:

    • Assessment of mitochondrial membrane potential using indicators like TMRM or JC-1 to ensure observed phenotypes are not due to general mitochondrial dysfunction .

    • Electron microscopy to examine mitochondrial ultrastructure, particularly when studying mutants with potential impact on mitochondrial morphology.

  • Ion Specificity Controls:

    • Parallel experiments with various divalent cations (Mg²⁺, Ca²⁺, Mn²⁺, etc.) to determine specificity of observed effects .

    • Chelation controls using EDTA or specific ion chelators to confirm ion-dependent effects .

    • Experiments in the presence of ionophores (e.g., A23187 for divalent cations) to bypass channel-mediated ion transport.

  • Genetic Controls:

    • MRS2 knockout or knockdown cells as negative controls .

    • Rescue experiments with wild-type MRS2 in knockout backgrounds to confirm phenotype specificity .

    • Expression of functionally characterized mutants (e.g., R332S for enhanced conductance, D216Q for altered Mg²⁺ sensing) as comparative controls .

  • Pharmacological Controls:

    • Treatment with known inhibitors of mitochondrial function (e.g., oligomycin, FCCP) to distinguish MRS2-specific effects from general mitochondrial dysfunction.

    • Comparison with other Mg²⁺ transport pathways using specific inhibitors where available.

  • Assay-Specific Controls:

    • For apoptosis assays: Positive controls using established apoptosis inducers (e.g., staurosporine) .

    • For drug resistance studies: Dose-response curves with multiple drugs to distinguish between specific and general resistance mechanisms .

    • For cell migration assays: Comparison with established migration modulators (e.g., growth factors, migration inhibitors) .

    • For Mg²⁺ uptake assays: Calibration with known Mg²⁺ concentrations and verification with orthogonal measurement techniques .

  • Technical Controls:

    • Empty vector controls for overexpression studies .

    • Non-targeting siRNA/shRNA controls for knockdown experiments .

    • Vehicle controls for any treatments applied.

    • Time course measurements to distinguish transient from sustained effects.

  • Physiological Relevance Controls:

    • Comparison of effects under normal and stressed conditions (e.g., nutrient deprivation, oxidative stress).

    • Assessment of phenotypes in multiple cell types to determine cell-type specificity.

    • Confirmation of key findings in primary cells when possible, rather than relying solely on immortalized cell lines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.