Recombinant Human Magnesium transporter protein 1 (MAGT1)

Shipped with Ice Packs
In Stock

Description

Magnesium Transport

Recombinant MAGT1 facilitates Mg²⁺ uptake in T cells, maintaining cytoplasmic Mg²⁺ levels critical for immune activation. Deficiency impairs CD8⁺ T-cell responses to viral infections (e.g., Epstein-Barr virus) .

B. N-Linked Glycosylation

MAGT1 serves as an accessory subunit of the oligosaccharyltransferase (OST) complex, enabling posttranslational glycosylation of cysteine-proximal sites in glycoproteins . This activity is Mg²⁺-sensitive and partially overlaps with its paralog TUSC3 .

Immune Dysregulation

  • MAGT1-deficient mice exhibit accelerated arterial thrombosis, hyperactive platelets, and increased TRPC6-dependent calcium influx .

  • In humans, mutations cause XMEN syndrome (X-linked immunodeficiency with Mg²⁺ defect), characterized by chronic EBV infections and lymphoproliferative disorders .

Cancer Associations

  • Overexpression in colorectal cancer (CRC) correlates with advanced tumor stages, metastasis, and chemotherapy resistance .

  • MAGT1 knockdown reduces CRC cell proliferation and migration in vitro .

Glycosylation Defects

  • MAGT1 loss disrupts glycosylation of immune receptors (e.g., CD28) and NKG2D, impairing antiviral responses .

  • Mg²⁺ supplementation partially restores glycosylation in MAGT1-deficient cells .

Clinical Relevance

  • Gene Therapy: Restoration of MAGT1 in hematopoietic stem cells could correct immune defects in XMEN patients .

  • Drug Targets: TRPC6 inhibitors normalize platelet hyperactivity in MAGT1-deficient models .

Experimental Tools

  • Antibody Production: MAGT1-specific antibodies (e.g., Proteintech 17430-1-AP) are validated for Western blot, IHC, and IF .

  • CRISPR Models: MAGT1-KO cell lines elucidate its roles in Mg²⁺ homeostasis and glycosylation .

Production Challenges

  • Solubility: MAGT1’s transmembrane domains require detergent-based extraction for recombinant expression .

  • Glycoform Variability: Posttranslational modifications affect molecular weight (38–47 kDa), complicating purification .

Future Directions

  • Mechanistic Studies: Resolve MAGT1’s dual roles in ion transport vs. glycosylation using cryo-EM .

  • Therapeutic Trials: Evaluate Mg²⁺ supplementation or TRPC6 blockers in XMEN patients .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please include them in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MAGT1; IAG2; PSEC0084; UNQ628/PRO1244; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-335
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MAGT1
Target Protein Sequence
QRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPK RGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS
Uniprot No.

Target Background

Function
Magnesium transporter protein 1 (MAGT1) acts as an accessory component of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. MAGT1 is involved in N-glycosylation of STT3B-dependent substrates. It is specifically required for the glycosylation of a subset of acceptor sites located near cysteine residues, acting redundantly with TUSC3 in this function. In its oxidized form, MAGT1 is proposed to form transient mixed disulfides with a glycoprotein substrate, facilitating access of STT3B to the unmodified acceptor site. MAGT1 also exhibits oxidoreductase-independent functions within the STT3B-containing OST complex, potentially involving substrate recognition. Additionally, MAGT1 may be involved in Mg(2+) transport in epithelial cells.
Gene References Into Functions
  1. Immunohistochemical evaluation of MAGT1 and AKAP13 expression in clinical hepatocellular carcinoma tissues suggested that both proteins were strongly expressed in tumor tissues. These tissues exhibited significantly higher average immunoreactive scores of Remmele and Stegner (IRS) than non-tumor tissues. PMID: 26617690
  2. A 0.8 kb intronic duplication in MAGT1 and a single base pair deletion in the last exon of ATRX were identified in a family with five males demonstrating intellectual disability (ID) and unusual skin findings (e.g., generalized pruritus). PMID: 24130152
  3. A deficiency in magnesium transporter 1 (MAGT1), an Mg(2+)-specific transporter, leads to the absence of a T cell antigen receptor-stimulated Mg(2+)flux and an attenuation of T cell activation. PMID: 21983175
  4. A novel gene encoding a protein involved in Mg2+-evoked transport, MagT1, was identified. The findings suggest that MagT1 may provide a selective and regulated pathway for Mg2+ transport in epithelial cells. PMID: 15804357
  5. A study demonstrated that mutations in two OTase-subunit genes, N33/TUSC3 and IAP, result in autosomal-recessive nonsyndromic mental retardation. PMID: 18455129
  6. MagT1 is universally expressed in all tissues, and its expression level is upregulated in low extracellular Mg(2+). Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines. PMID: 19717468

Show More

Hide All

Database Links

HGNC: 28880

OMIM: 300715

KEGG: hsa:84061

STRING: 9606.ENSP00000354649

UniGene: Hs.323562

Involvement In Disease
Immunodeficiency, X-linked, with magnesium defect, Epstein-Barr virus infection and neoplasia (XMEN)
Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Expressed at very low levels in brain, lung and kidney.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.