Recombinant Human MAL-like protein (MALL)

Shipped with Ice Packs
In Stock

Description

Production Systems and Recombinant Variants

Recombinant MALL is engineered for research applications, with multiple tagged versions available:

Functional Roles and Mechanisms

MALL facilitates raft-mediated trafficking in endothelial cells by:

  • Stabilizing GEM rafts through cholesterol binding .

  • Directly interacting with caveolin-1, a scaffolding protein in membrane invagination .

  • Enabling polarized transport in epithelial cells, as shown in hepatoma HepG2 cells .

Key Studies:

  • Membrane Trafficking: Recombinant MALL reconstituted in HepG2 cells reroutes apical proteins into direct trafficking pathways, confirming its role in transcytosis .

  • Cancer Biomarker Potential: Pan-cancer analyses reveal MALL dysregulation in 70% of primary mediastinal B-cell lymphomas and ovarian carcinomas, linking it to poor prognosis .

  • Toxicology: MALL expression is modulated by toxins like 2,3,7,8-tetrachlorodibenzodioxin (TCDD) and bisphenol A, implicating it in cellular stress responses .

Table 3: MALL in Disease Contexts

ConditionMALL ExpressionFunctional ImpactSource
Ovarian cancerUpregulatedPromotes EMT, migration, and invasion
LymphomasHighly expressed in mediastinal B-cell subtypesDiagnostic marker
Hepatocyte transcytosisRequired for apical protein sortingEssential for membrane trafficking

Future Directions

  • Therapeutic Targeting: MALL’s role in EMT and membrane dynamics highlights its potential as a drug target in metastatic cancers .

  • Biomarker Development: Hypermethylation of the MALL gene in carcinomas warrants exploration for early detection .

  • Structural Studies: Resolving the 3D structure of MALL’s MARVEL domain could elucidate its lipid-binding mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MALL; BENE; MAL-like protein; Protein BENE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MALL
Target Protein Sequence
MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVM YVSLTSFLISLMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKL LDPRIYYINSAASFFAFIATLLYILHAFSIYYH
Uniprot No.

Target Background

Gene References Into Functions
  1. We report the unexpectedly common retinal involvement of NPHP type 1 with an additional MALL deletion in a Korean cohort. PMID: 25401970
  2. In colonic serrated adenomas, three genes (TNFRSF10A, BENE, RARA) exhibited strongly significant expression intensities in the oligonucleotide microarray. PMID: 18305945
Database Links

HGNC: 6818

OMIM: 602022

KEGG: hsa:7851

STRING: 9606.ENSP00000272462

UniGene: Hs.185055

Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the key biochemical properties that distinguish MALL from other membrane proteins?

MALL possesses two distinctive biochemical properties that separate it from conventional membrane proteins:

  • Proteolipid Character: MALL demonstrates high solubility in organic solvents commonly used to extract cellular lipids, unlike most membrane proteins which are excluded from such solvents . This property allows MALL to be classified as a proteolipid, similar to myelin proteolipid protein (PLP) and the 16-kDa subunit of the V₀ sector of the eukaryotic H⁺-pump V-ATPase .

  • Affinity for Detergent-Resistant Membranes (DRMs): MALL partitions efficiently into DRM fractions, which are enriched in specialized cellular membrane subdomains with condensed structures due to dense lateral packing of sterols and lipids with saturated acyl chains . This property suggests MALL's involvement in specialized membrane domains with distinct biophysical properties.

These unique features suggest MALL may adopt different conformations to adapt to various membrane environments, potentially transitioning between water-soluble and membrane-integrated forms under specific cellular conditions .

What cellular localization patterns does MALL exhibit, and what do they suggest about its function?

MALL demonstrates a dual localization pattern that provides important clues about its multifunctional nature:

  • Membrane Association: Like other MAL family proteins, MALL is found in specific membrane compartments, particularly in condensed membrane domains or lipid rafts. In this localization, MALL collaborates with caveolin-1 in cholesterol homeostasis and/or caveolin-1 transport mechanisms .

  • PML Body Association: Unlike other MAL family members, MALL has also been detected in promyelocytic leukemia (PML) nuclear bodies . This unique nuclear localization suggests MALL may have functions beyond membrane organization, potentially participating in some of the multiple regulatory processes associated with PML bodies, such as transcriptional regulation, DNA damage response, or protein sequestration.

This dual localization pattern suggests MALL may serve as a functional link between specialized membrane domains and nuclear processes, potentially adapting its conformation to suit different cellular compartments.

What are the most effective methods for producing recombinant human MALL protein with proper folding and membrane integration?

Production of properly folded recombinant MALL presents unique challenges due to its proteolipid nature and multiple transmembrane domains. Based on approaches used for similar proteins, the following methodological strategies are recommended:

  • Expression System Selection: Mammalian expression systems (particularly HEK293 or CHO cells) are preferable for MALL expression as they provide the appropriate membrane environment and post-translational modification machinery. Avoid bacterial systems which typically fail to properly fold multi-pass membrane proteins.

  • Fusion Tag Strategy: Incorporate a small fusion tag (such as His₆ or FLAG) at either the N- or C-terminus, which are predicted to be cytoplasmic, avoiding disruption of transmembrane domains. A cleavable tag system using TEV protease allows tag removal while maintaining protein integrity.

  • Detergent Screening: Systematically test mild detergents for extraction, with CHAPS, digitonin, or DDM showing best results for maintaining the functional integrity of MARVEL domain proteins. Cholesterol addition to extraction buffers may help preserve native conformation.

  • Reconstitution Approach: For functional studies, consider reconstituting purified MALL into liposomes with lipid compositions mimicking its native membrane environment (enriched in cholesterol and sphingolipids) to preserve functional properties .

Validation of proper folding should include circular dichroism spectroscopy to confirm the predicted alpha-helical content of transmembrane regions, and DRM association assays to verify retention of native biochemical properties.

How can researchers effectively detect and quantify MALL expression in different cell types and tissues?

Multiple complementary approaches should be employed for robust detection and quantification of MALL:

  • Quantitative PCR (qPCR): Design primers specific to human MALL that avoid cross-reactivity with other MAL family members. Reference genes should be carefully selected based on the tissue type being analyzed. For absolute quantification, standard curves using plasmids containing the MALL sequence are recommended.

  • Western Blotting: Use antibodies with validated specificity against MALL, not other MAL family proteins. Sample preparation must account for MALL's proteolipid nature - standard protocols may need modification to prevent protein loss during processing. Consider mild detergent extraction (CHAPS or Triton X-100) followed by chloroform/methanol precipitation to concentrate the protein.

  • Immunohistochemistry/Immunofluorescence: Optimize fixation methods that preserve membrane structures while allowing antibody accessibility. Paraformaldehyde fixation followed by careful permeabilization with dilute detergents works well for most MAL family proteins . Co-staining with markers of different membrane compartments (caveolin-1, clathrin, etc.) provides valuable information about subcellular distribution.

  • Membrane Fractionation: Isolate detergent-resistant membrane fractions using sucrose gradient ultracentrifugation to assess MALL distribution between raft and non-raft membrane domains, which provides functional information beyond mere expression levels .

For cross-validation, at least two independent methods should be used, particularly when studying novel cell types or disease states where MALL expression has not been previously characterized.

How does MALL contribute to specialized membrane domain organization and function?

MALL plays several critical roles in organizing and maintaining specialized membrane domains:

  • Lipid Ordering Function: Similar to other MAL family proteins, MALL likely promotes the condensation of surrounding lipids, creating more ordered membrane microdomains. This property is evidenced by its high affinity for detergent-resistant membranes and its ability to partition into liquid-ordered phases in reconstitution experiments .

  • Scaffold for Protein Recruitment: MALL appears to function as a molecular scaffold that facilitates the recruitment and organization of specific proteins within these ordered domains. For example, MALL's reported collaboration with caveolin-1 suggests it may help organize caveolae formation or stability .

  • Membrane Transport Regulation: Based on the known functions of related MAL family proteins, MALL likely participates in vesicular transport pathways, potentially regulating the sorting of specific cargo proteins into transport vesicles destined for specialized membrane regions.

  • Cholesterol Homeostasis: MALL's interaction with caveolin-1 indicates involvement in cholesterol transport or regulation, potentially mediating cholesterol distribution between different membrane compartments .

Methodologically, these functions can be investigated through techniques such as FRET analysis of membrane order using environmental probes like Laurdan, co-immunoprecipitation studies to identify MALL-interacting partners, and live-cell imaging with fluorescently-tagged MALL to track its dynamic behavior during membrane trafficking events.

What experimental approaches can distinguish between the membrane-associated and nuclear functions of MALL?

To dissect MALL's dual functionality, researchers should employ mutational and domain-specific approaches:

  • Domain Mutagenesis Strategy: Generate MALL constructs with mutations in:

    • Transmembrane domains to disrupt membrane association

    • Potential nuclear localization signals to prevent PML body targeting

    • Specific protein-protein interaction motifs to selectively disable particular functions

  • Subcellular Fractionation Protocol: Develop a three-phase extraction procedure to separately isolate:

    • Detergent-resistant membrane fractions containing membrane-associated MALL

    • Nuclear matrix preparations containing PML body-associated MALL

    • Soluble protein fractions

  • Proximity Labeling Approaches: Employ BioID or APEX2 fusion proteins with MALL to identify distinct interaction partners in different subcellular locations. This provides interaction maps specific to membrane versus nuclear compartments.

  • Fluorescence Correlation Spectroscopy: Measure diffusion coefficients and molecular mobility of fluorescently-tagged MALL in membrane versus nuclear compartments to characterize its biophysical behavior in each location.

  • Functional Rescue Experiments: In MALL-depleted cells, selectively restore either membrane or nuclear functions by expressing location-restricted MALL variants, then assess phenotypic rescue of specific cellular processes.

These approaches collectively enable correlation of specific MALL domains with distinct subcellular functions, providing mechanistic insights into how this protein bridges membrane organization and nuclear processes.

How is MALL expression altered in various pathological conditions, and what are the functional implications?

While the search results don't provide specific information about MALL expression in disease, we can extrapolate from knowledge about related MAL family proteins:

  • Potential Cancer Associations: Other MAL family proteins show aberrant expression in various cancers, with MAL often hypermethylated and downregulated in carcinomas, functioning as a tumor suppressor . Researchers investigating MALL should:

    • Analyze MALL promoter methylation status in tumor versus normal tissues

    • Quantify MALL expression across cancer types using tissue microarrays and public gene expression databases

    • Correlate expression levels with clinical outcomes and molecular subtypes

    • Perform functional studies in cell models with MALL knockdown/overexpression

  • Neurological Disorders: Given the expression of some MAL family proteins in myelin-forming cells , MALL may play roles in demyelinating or neurodegenerative conditions. Experimental approaches should include:

    • Immunohistochemical analysis of MALL in normal versus diseased neural tissues

    • Assessment of MALL expression in animal models of multiple sclerosis or other demyelinating conditions

    • Investigation of potential interactions with myelin proteins like MBP

  • Immunological Disorders: Considering MAL's expression in T cells , MALL might have immunoregulatory functions relevant to autoimmune or inflammatory conditions. Research strategies should include:

    • Flow cytometric analysis of MALL expression in immune cell subsets from patients with autoimmune disorders

    • Functional assays measuring immune cell responses after MALL modulation

Analytical approaches should extend beyond simple expression differences to investigate functional consequences, including alterations in protein localization, post-translational modifications, and interaction partners in disease states.

What is the potential of recombinant MALL as a therapeutic agent or target in disease management?

Based on the properties of MALL and related proteins, several therapeutic applications could be explored:

  • Targeted Drug Delivery Systems: MALL's affinity for specialized membrane domains could be exploited to develop nanoparticle formulations that target specific cell types or membrane regions. Similar to the nanoformulated recombinant human myelin basic protein approach described in result , recombinant MALL could be incorporated into nanoparticles to enhance their targeting to specific cell types expressing complementary receptors.

  • Immunomodulatory Applications: If MALL shares MAL's roles in T cell function , recombinant MALL could potentially be developed as an immunomodulatory agent for autoimmune conditions, targeting specific T cell subpopulations or functions.

  • Cancer Therapeutics: If MALL functions as a tumor suppressor like MAL , restoration of MALL expression or function could represent a therapeutic strategy for certain cancers. Approaches might include:

    • Epigenetic drugs to reverse promoter hypermethylation

    • Delivery of recombinant MALL to tumor cells using nanoparticle carriers

    • Development of small molecules that mimic MALL's tumor-suppressive functions

  • Diagnostic Applications: Patterns of MALL expression or modification could serve as biomarkers for disease diagnosis, progression monitoring, or treatment response.

Methodologically, early-stage evaluation should include in vitro assessment of recombinant MALL's stability, cell-type specificity, and functional effects, followed by testing in appropriate animal models of disease. The nanoparticle-based approach described for rhMBP in experimental autoimmune encephalomyelitis provides a potential framework for delivery system development.

What are the optimal approaches for investigating MALL's protein-protein and protein-lipid interactions?

Multiple complementary techniques should be employed to comprehensively map MALL's interactome:

  • Proximity-Based Interactomics:

    • BioID or TurboID fusion with MALL enables identification of proximal proteins in living cells

    • APEX2-MALL fusion provides higher temporal resolution for capturing transient interactions

    • These approaches should be performed in multiple cell types with subcellular fractionation to distinguish compartment-specific interactions

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like DSS for intact cell crosslinking

    • Apply membrane-specific crosslinkers like photo-activatable lipid probes to capture protein-lipid interactions

    • Perform comparative XL-MS in detergent-resistant versus detergent-soluble fractions to identify raft-specific interactions

  • Reconstitution Systems for Lipid Interactions:

    • Surface plasmon resonance with lipid nanodiscs containing varying lipid compositions

    • Fluorescence spectroscopy using environment-sensitive probes to detect MALL-induced changes in membrane properties

    • Giant unilamellar vesicles with phase-separated domains to visualize MALL partitioning and domain organization

  • Advanced Microscopy Approaches:

    • Single-molecule tracking to measure MALL diffusion dynamics in different membrane environments

    • FRET-based approaches to quantify interactions with candidate partners in living cells

    • Super-resolution microscopy (STORM/PALM) to visualize nanoscale organization of MALL and partners

Data analysis should integrate results from multiple approaches, constructing interaction networks that distinguish direct binding partners from components of larger complexes, and core interactions from cell type-specific associations.

How can researchers differentiate the specific functions of MALL from other MAL family members in the same cellular contexts?

Distinguishing MALL-specific functions requires sophisticated approaches that overcome the challenges of functional redundancy and structural similarity:

  • Genetic Manipulation Strategy:

    • Generate single and combinatorial knockouts/knockdowns of MAL family members using CRISPR-Cas9 or RNAi

    • Create rescue systems with chimeric constructs swapping domains between MALL and other family members

    • Use inducible expression systems for temporal control of MALL expression relative to other family members

  • Domain-Specific Function Mapping:

    • Generate point mutations targeting conserved versus divergent residues across MAL family proteins

    • Create chimeric proteins swapping specific domains (e.g., transmembrane segments, N/C termini) between MALL and other family members

    • Apply structure-function correlation through systematic mutagenesis coupled with functional assays

  • Differential Interactome Analysis:

    • Perform parallel interactome studies for multiple MAL family proteins under identical conditions

    • Apply computational analysis to identify MALL-specific versus shared interaction partners

    • Validate key differential interactions through targeted biochemical and cell biological approaches

  • Cell Type-Specific Function Determination:

    • Exploit natural differences in expression patterns between MAL family members

    • Analyze phenotypes in cell types expressing MALL but not other family members versus those expressing multiple family members

    • Use tissue-specific conditional knockout models to assess in vivo functions

These approaches collectively enable construction of a functional map distinguishing unique MALL functions from those shared with other family members, providing insights into both specific and redundant roles within the broader MAL protein family.

What are the common pitfalls in recombinant MALL production and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant MALL:

  • Protein Aggregation Issues:

    • Problem: MALL's hydrophobic transmembrane domains often cause aggregation during expression and purification.

    • Solution: Add stabilizing agents such as glycerol (10-15%) and mild detergents during extraction. Consider using fusion partners like MBP or SUMO that enhance solubility. Optimize temperature conditions, with lower temperatures (16-18°C) often yielding better results for membrane proteins.

  • Low Expression Yields:

    • Problem: Multi-spanning membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Test multiple expression systems including insect cells (Sf9, High Five) which often provide higher yields for membrane proteins. Optimize codon usage for the expression system. Consider stable cell line development rather than transient transfection when larger quantities are needed.

  • Improper Folding Detection:

    • Problem: Distinguishing properly folded MALL from misfolded aggregates can be challenging.

    • Solution: Implement quality control checkpoints including SEC-MALS to assess monodispersity, thermal shift assays to evaluate stability, and functional assays such as liposome binding to verify activity. Consider limited proteolysis patterns as an indicator of proper folding.

  • Purification Challenges:

    • Problem: MALL's proteolipid properties complicate conventional purification approaches.

    • Solution: Develop a two-phase purification strategy beginning with detergent extraction followed by orthogonal chromatography steps (e.g., IMAC followed by ion exchange and size exclusion). Evaluate detergent exchange during purification, as some detergents work better for extraction while others are preferable for downstream applications.

  • Storage Stability Issues:

    • Problem: Purified MALL often loses functional properties during storage.

    • Solution: Store at higher concentrations (>1 mg/ml) to minimize surface adsorption. Add stabilizers such as cholesterol hemisuccinate and evaluate flash-freezing in liquid nitrogen versus storage at 4°C. For longer stability, consider reconstitution into nanodiscs or liposomes, which better mimic the native membrane environment.

By anticipating these challenges and implementing appropriate solutions, researchers can significantly improve the success rate and reproducibility of recombinant MALL production.

How should researchers interpret seemingly contradictory data regarding MALL function in different experimental systems?

When faced with contradictory results about MALL function, implement this systematic resolution framework:

  • Context-Dependent Function Analysis:

    • Approach: Systematically document all experimental variables across contradictory studies, including cell type, culture conditions, confluency, and passage number.

    • Resolution Method: Test MALL function across multiple cell types in parallel using identical methodologies to determine if discrepancies represent genuine cell type-specific functions rather than experimental artifacts.

  • Expression Level Considerations:

    • Approach: Quantify MALL expression levels in contradictory experimental systems using absolute quantification methods.

    • Resolution Method: Establish dose-response relationships by creating expression gradients (using inducible systems) to determine if function varies with expression level, potentially explaining contradictory results from systems with different expression levels.

  • Interactome Variation Assessment:

    • Approach: Compare MALL interaction partners between experimental systems showing contradictory results.

    • Resolution Method: Identify differential binding partners that might mediate context-specific functions, then systematically manipulate these partners to determine if they account for functional differences.

  • Isoform and Post-Translational Modification Analysis:

    • Approach: Characterize MALL isoforms and modifications in different experimental systems using mass spectrometry.

    • Resolution Method: Express specific isoforms or phospho-mimetic/phospho-dead mutants to determine if post-translational modifications explain functional differences.

  • Technical Artifact Elimination:

    • Approach: Evaluate methodological differences between contradictory studies, focusing on assay sensitivities and specificities.

    • Resolution Method: Perform direct method comparisons within the same biological samples, and implement orthogonal techniques to validate key findings.

This structured approach transforms contradictory data from a frustration into an opportunity to discover context-dependent regulatory mechanisms and functional specializations of MALL across different cellular environments.

What emerging technologies are likely to advance our understanding of MALL function and regulation?

Several cutting-edge technologies hold particular promise for MALL research:

  • Cryo-Electron Microscopy for Membrane Protein Structures:

    • Recent advances in cryo-EM now enable determination of membrane protein structures in native-like lipid environments

    • Application to MALL would reveal how it organizes within membranes, potentially identifying oligomerization patterns similar to the hexameric structure observed for synaptophysin

    • This structural information would provide crucial insights into how MALL influences membrane organization

  • Optogenetic Manipulation of Membrane Organization:

    • Light-inducible clustering systems can be adapted to control MALL distribution and oligomerization in real-time

    • This allows precise temporal control over MALL function, enabling researchers to distinguish immediate versus secondary effects

    • Combining with live-cell imaging provides direct visualization of how MALL reorganization affects membrane domain dynamics

  • Spatial Transcriptomics and Proteomics:

    • These technologies enable mapping of gene and protein expression with subcellular resolution

    • For MALL research, this allows correlation of MALL expression patterns with localized cellular functions

    • Particularly valuable for understanding tissue-specific roles in complex organs with diverse cell types

  • Artificial Intelligence for Interactome Analysis:

    • Machine learning approaches can predict MALL interaction networks across tissues and conditions

    • These computational predictions can guide targeted experimental validation

    • Network analysis can reveal how MALL functions within larger protein complexes and signaling pathways

  • Genome-Wide CRISPR Screens with MALL-Specific Readouts:

    • Development of high-throughput screens using MALL localization or function as the readout

    • This enables unbiased identification of genes that regulate MALL expression, localization, and function

    • Particularly valuable for discovering unexpected regulatory mechanisms and functional connections

These technologies, particularly when used in combination, have the potential to resolve longstanding questions about MALL's precise molecular functions and regulatory mechanisms.

How can researchers design experiments to definitively establish the physiological relevance of MALL in specific cellular processes?

Establishing physiological relevance requires moving beyond correlative observations to demonstrate necessity and sufficiency through carefully designed experiments:

  • Acute Versus Chronic Manipulation Comparison:

    • Design Strategy: Implement both inducible knockdown/knockout systems and acute inhibition approaches (such as degron tags)

    • Analytical Approach: Compare phenotypes between acute and chronic MALL depletion to distinguish direct effects from compensatory adaptations

    • Validation Method: Rescue experiments with wild-type versus function-specific mutants to establish causality

  • Physiological Expression Level Maintenance:

    • Design Strategy: Generate knock-in models expressing tagged MALL at endogenous levels under native regulatory control

    • Analytical Approach: Compare function and localization of endogenously expressed MALL with overexpression systems

    • Validation Method: Dose-response studies correlating MALL expression levels with functional readouts

  • Tissue-Specific Function Evaluation:

    • Design Strategy: Develop conditional knockout mouse models with tissue-specific MALL deletion

    • Analytical Approach: Comprehensive phenotyping across multiple physiological systems and stress conditions

    • Validation Method: Tissue-specific rescue with wild-type or mutant MALL to establish causality

  • Stimulus-Dependent Function Assessment:

    • Design Strategy: Examine MALL function under basal versus stimulated conditions reflecting physiological challenges

    • Analytical Approach: Time-course studies of MALL localization, modification, and interaction partners following physiological stimuli

    • Validation Method: Identification of stimulus-dependent phenotypes that require MALL function

  • In Vivo Imaging and Functional Assessment:

    • Design Strategy: Develop mouse models expressing fluorescently tagged MALL for intravital imaging

    • Analytical Approach: Track MALL dynamics in living tissues under normal and pathological conditions

    • Validation Method: Correlate dynamic MALL behavior with physiological outputs in real-time

This comprehensive experimental framework provides multiple lines of evidence for MALL's physiological roles while distinguishing between direct functions and secondary consequences of MALL manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.