Recombinant Human Mannose-P-dolichol utilization defect 1 protein (MPDU1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

MPDU1 is a 247-amino acid endoplasmic reticulum (ER) membrane protein encoded by the MPDU1 gene (Gene ID: 9526) . Its primary role involves facilitating the utilization of mannose-P-dolichol (Dol-P-Man) and dolichol-P-glucose (Dol-P-Glc) in lipid-linked oligosaccharide (LLO) synthesis and glycosylphosphatidylinositol (GPI) anchor formation . Key structural features include:

  • Molecular Weight: ~22 kDa (His-tagged recombinant form) .

  • Topology: Predicted 7-transmembrane (TM) domains with conserved proline-glutamine (PQ) motifs in the C-terminal region .

FeatureDescriptionSource
Gene LocusChromosome 17p13.2
Interacting ProteinsDPM1, DPM2 (dolichol-phosphate mannose synthase), DOLPP1, SRD5A3 (polyprenol reductase)
Disease AssociationCongenital disorder of glycosylation type If (CDG-If)

Recombinant Protein Production

Recombinant MPDU1 is typically expressed in E. coli with an N-terminal His6 tag for purification via immobilized metal affinity chromatography (IMAC) . Key production parameters include:

ParameterValueSource
Expression SystemE. coli
Purification MethodIMAC chromatography
Concentration≥0.5 mg/mL
BufferPBS with 1M urea (pH 7.4)
ApplicationsAntibody blocking/neutralizing, control for immunological assays

Example Product Specifications (Novus Biologicals NBP1-84570PEP):

  • Sequence Coverage: Full-length mature protein (amino acids 2–247).

  • Storage: -20°C; avoid freeze-thaw cycles .

Biological Role and Clinical Relevance

MPDU1 is essential for all Dol-P-Man-dependent glycosylation reactions, including:

  1. N-glycosylation: Transfer of LLOs to nascent proteins.

  2. O-mannosylation: Modification of serine/threonine residues.

  3. GPI anchor synthesis: Anchoring proteins to cell membranes .

Deficiencies in MPDU1 lead to CDG-If, characterized by:

  • Biochemical Hallmarks: Hypoglycosylated transferrin, truncated LLOs (e.g., Glc3Man9GlcNAc2), and reduced Dol-P-Man levels .

  • Clinical Features:

    • Neurological: Developmental delay, hypotonia.

    • Cardiac: Dilated cardiomyopathy.

    • Muscular: Elevated creatine kinase (CK), dystroglycanopathy (abnormal α-dystroglycan O-mannosylation) .

Genetic Mutations and Diagnostic Insights

Over 20 pathogenic MPDU1 mutations have been identified, including missense and nonsense variants. Common mutations include:

MutationProtein ImpactClinical OutcomeSource
c.218G>A (p.Gly73Glu)Disrupted TM domain packingSevere CDG-If with early lethality
c.221T>C (p.Leu74Ser)Altered PQ-loop stabilityCardiac and muscular dystrophy
*c.308G>T (synonymous)No functional impact (likely benign)No CDG association

Diagnostic workflows often combine biochemical (e.g., transferrin isoform profiling) and genetic testing (e.g., MPDU1 sequencing) .

Research Applications and Future Directions

Recombinant MPDU1 is utilized to:

  • Validate Antibodies: Confirm specificity in immunoblotting or ELISA .

  • Model CDG Pathogenesis: Study LLO biosynthesis defects in vitro .

  • Therapeutic Development: Investigate protein replacement or gene therapy strategies for CDG-If .

Emerging research highlights MPDU1’s interaction with SRD5A3 (polyprenol reductase) and its role in maintaining dolichol availability for glycosylation .

Comparative Analysis of Recombinant MPDU1 Products

SupplierTagConcentrationPurityKey Application
Novus Biologicals (NBP1-84570PEP)His6-ABP0.5 mg/mL>80%Antibody blocking
Creative Biomart (RFL34155HF)HisN/AN/AFunctional assays

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly specify it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery information.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your experiments.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag during production.
Synonyms
MPDU1; Mannose-P-dolichol utilization defect 1 protein; Suppressor of Lec15 and Lec35 glycosylation mutation homolog; SL15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-247
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MPDU1
Target Protein Sequence
AAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQ VFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVM HYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGH TGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPH KQKKAQ
Uniprot No.

Target Background

Function
MPDU1 plays a crucial role in the normal utilization of mannose-dolichol phosphate (Dol-P-Man), an essential component in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors.
Gene References Into Functions
  1. These experiments also confirmed that protein levels of CEACAM-1, a protein involved in cell adhesion, are dependent on LLO biosynthesis in vivo. Kato III cells and the MPDU1-rescued Kato IIIM cells provide a valuable model for investigating the consequences of defective LLO biosynthesis both in vitro and in vivo. PMID: 29671116
  2. Cystinosin, MPDU1, SWEETs and KDELR belong to a well-defined protein family with putative function of cargo receptors. PMID: 22363504
Database Links

HGNC: 7207

OMIM: 604041

KEGG: hsa:9526

STRING: 9606.ENSP00000250124

UniGene: Hs.246381

Involvement In Disease
Congenital disorder of glycosylation 1F (CDG1F)
Protein Families
MPDU1 (TC 2.A.43.3) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MPDU1 in glycosylation pathways?

MPDU1 functions as an essential protein in the endoplasmic reticulum membrane that facilitates the utilization of mannose-P-dolichol donor in the synthesis of lipid-linked oligosaccharides (LLOs) and glycosylphosphatidylinositols. It plays a critical role in both N-glycosylation and O-mannosylation pathways, which are fundamental processes for proper protein folding and function . When MPDU1 is deficient, cells accumulate truncated LLOs corresponding to Man5GlcNac2 species, indicating its role in enabling the transfer of mannose from mannose-P-dolichol to growing glycan chains . Experimentally, this has been demonstrated through fluorophore-assisted carbohydrate electrophoresis (FACE) analysis, which showed restoration of mature LLO synthesis following MPDU1 re-expression in deficient cell lines .

How does MPDU1 interact with other components of the dolichol pathway?

MPDU1 does not function in isolation but coordinates with multiple components in the dolichol pathway. It works downstream of dolichol-phosphate-mannose (DPM) synthesis, which involves DPM1, DPM2, and DPM3 proteins. MPDU1 specifically enables the utilization of DPM as a mannose donor . The functional relationship between MPDU1 and these pathway components can be investigated through co-immunoprecipitation studies and proximity labeling techniques. Research shows that defects in DPM synthesis (DOLK-CDG, DPM1-CDG, DPM2-CDG, and DPM3-CDG) share biochemical similarities with MPDU1-CDG, suggesting they function in a coordinated manner within the pathway .

What are the structural characteristics of the MPDU1 protein?

MPDU1 is an endoplasmic reticulum membrane protein with multiple transmembrane domains. While detailed crystal structures remain to be elucidated, sequence analysis and topological studies indicate it contains multiple hydrophobic regions consistent with membrane integration. The protein contains specific domains that enable it to recognize and facilitate the utilization of mannose-P-dolichol. Mutations affecting conserved residues, such as the p.Gly168Glu variant, can severely disrupt protein function, highlighting the importance of these structural elements . Structural predictions using in silico modeling suggest that MPDU1 may form a channel or binding pocket that accommodates dolichol-linked substrates within the ER membrane.

What cell models are available for studying MPDU1 function?

Kato III cells represent a valuable model system for studying MPDU1 function. These human gastric carcinoma cells naturally lack functional MPDU1, resulting in truncated LLO biosynthesis . Researchers have successfully developed MPDU1-rescued Kato III cells (Kato IIIM) that restore mature LLO synthesis, providing an ideal comparison model. This cell pair allows for investigation of glycosylation-dependent processes both in vitro and in vivo through xenograft studies. Other established models include CHO cell lines with MPDU1 defects, although species differences may complicate protein profiling studies . When working with these models, researchers should confirm the glycosylation status through lectin binding assays, as MPDU1 restoration changes cell surface glycans from predominantly high mannose type to complex glycan type .

What methods are recommended for detecting alterations in protein glycosylation due to MPDU1 deficiency?

Multiple complementary techniques provide comprehensive assessment of glycosylation changes resulting from MPDU1 deficiency:

  • Fluorophore-Assisted Carbohydrate Electrophoresis (FACE): This technique directly visualizes LLO species, revealing the accumulation of truncated Man5GlcNAc2 structures in MPDU1-deficient cells versus complete LLO structures in cells with functional MPDU1 .

  • Lectin Binding Assays: Differential sensitivity to lectins such as Concanavalin A (ConA) and phytohemagglutinin (PHA) in the presence of swainsonine can indirectly measure changes in surface glycoprotein composition .

  • Transferrin Isoform Analysis: Elevated disialotransferrin in serum serves as a biomarker for N-glycosylation defects in MPDU1-CDG patients .

  • O-Mannosylation Assessment: Analysis of alpha-dystroglycan glycosylation through specific antibodies can detect reduced O-mannosylation, which is characteristic of MPDU1 deficiency .

How can researchers effectively utilize antibodies for MPDU1 detection in various experimental contexts?

When designing experiments involving MPDU1 detection, researchers should consider several methodological aspects:

For immunohistochemistry (IHC) applications, polyclonal antibodies against human MPDU1 have been validated at dilutions between 1:20 and 1:200 . Optimal results require proper antigen retrieval techniques, typically using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0). For immunofluorescence/immunocytochemistry (IF/ICC) applications, dilutions between 1:50 and 1:200 are recommended . Antibodies raised against the N-terminal region (amino acids 1-36) of human MPDU1 have demonstrated high specificity .

For protein expression analysis, Western blotting protocols should account for MPDU1's membrane protein nature by including appropriate detergents in lysis buffers. Verification of specificity through knockout/knockdown controls is essential, particularly when studying novel mutations or contexts. Quantitative analyses should utilize standardized loading controls appropriate for membrane proteins.

What is the spectrum of clinical presentations in patients with MPDU1 mutations?

MPDU1 mutations lead to congenital disorder of glycosylation type If (MPDU1-CDG) with a diverse clinical spectrum. The clinical manifestations include:

  • Neurological features: Developmental delay, hypotonia, and pontocerebellar hypoplasia

  • Hepatic involvement: Hepatomegaly with severe duct plate malformation and massive dilatation of the biliary duct system

  • Ophthalmological abnormalities: Buphthalmos and congenital glaucoma

  • Cardiovascular manifestations: Dilated cardiomyopathy

  • Musculoskeletal findings: Elevated creatine kinase levels

  • Renal abnormalities: Cortical tubular and glomerular cysts

  • Cutaneous features: Ichthyosis

  • Growth parameters: Symmetric growth restriction

  • Facial features: Facial dysmorphism

Interestingly, unlike some other CDG types, some MPDU1-CDG patients lack skin involvement . The severity and combination of symptoms vary between patients, suggesting potential genotype-phenotype correlations that warrant further investigation through comprehensive case cohort studies.

How do MPDU1 mutations affect cellular processes beyond glycosylation?

MPDU1 deficiency impacts multiple cellular processes extending beyond direct glycosylation defects:

Cell Adhesion Modulation: MPDU1 expression significantly alters cell-cell adhesion patterns. Kato IIIM cells (with restored MPDU1) display increased cell-cell adhesion compared to parental Kato III cells, which has been observed both in vitro and in xenograft tumor models .

Transcriptional Reprogramming: Re-expression of MPDU1 activates an alternative transcriptional program regulating ER and plasma membrane proteins. Gene ontology analysis reveals overrepresentation of terms corresponding to biological membranes, endoplasmic reticulum, and endomembrane systems .

Protein Expression Profiles: MPDU1 restoration increases expression of specific glycoproteins, including CEACAM-1, CEACAM-5, ADAM-15, TIMP-1, Nestin-2, and Integrin B5, as demonstrated through protein array analysis .

Ciliary Function: The observation of ciliopathy-like phenotypes in patients with MPDU1 mutations suggests potential roles in ciliary structure or function, indicating MPDU1-CDG should be considered in the differential diagnosis of infantile ciliopathy-like disorders .

What biomarkers are useful for diagnosing and monitoring MPDU1-CDG?

Diagnosis and monitoring of MPDU1-CDG rely on several complementary biomarkers:

Serum Transferrin Glycoform Analysis: Elevated disialotransferrin in serum serves as a primary screening biomarker for N-glycosylation defects in MPDU1-CDG . This can be assessed using various methods including isoelectric focusing, high-performance liquid chromatography, or capillary electrophoresis.

Lipid-Linked Oligosaccharide Profiling: Analysis of LLO species in patient fibroblasts typically reveals shorter structures, providing a specific diagnostic marker . This requires specialized techniques like FACE or mass spectrometry.

Creatine Kinase Levels: Elevated serum creatine kinase can indicate muscle involvement and may serve as a monitoring biomarker for disease progression .

α-Dystroglycan Glycosylation: Reduced O-mannosylation of α-dystroglycan can be detected using specific antibodies that recognize glycosylated epitopes, offering insight into the extent of O-mannosylation defects .

Genetic Analysis: Identification of pathogenic variants in the MPDU1 gene through next-generation sequencing provides definitive diagnosis and enables family studies .

How does MPDU1 specifically regulate CEACAM1 expression and what are the implications for cellular adhesion?

MPDU1 significantly influences CEACAM1 expression levels through mechanisms that appear to be both glycosylation-dependent and potentially transcriptionally regulated. Protein array analysis demonstrated that CEACAM-1 is expressed at higher levels in cells with functional MPDU1 compared to MPDU1-deficient cells . This regulation has direct functional consequences on cellular adhesion, as evidenced by the distinctive growth pattern observed in Kato IIIM cells, which display increased cell-cell adhesion under normal culture conditions .

  • Site-directed mutagenesis of CEACAM1 N-glycosylation sites followed by functional adhesion assays

  • Glycoproteomic analysis comparing glycan structures on CEACAM1 in MPDU1-proficient versus deficient cells

  • Chromatin immunoprecipitation studies to identify potential transcriptional regulators activated by MPDU1 restoration

What are the potential therapeutic approaches for targeting MPDU1-related disorders?

Developing therapeutic strategies for MPDU1-CDG requires multi-faceted approaches:

Gene Therapy Approaches: Viral vector-mediated delivery of functional MPDU1 could potentially correct the underlying genetic defect. The successful rescue of glycosylation defects in Kato III cells through MPDU1 reexpression provides proof-of-concept for this approach . Researchers should consider tissue-specific delivery systems targeting the most affected organs.

Pharmacological Chaperones: For missense mutations that affect protein folding rather than completely abolishing function (like the reported p.Gly168Glu variant), small molecules that stabilize the mutant protein might restore partial function . High-throughput screening methodologies using cellular glycosylation readouts could identify candidate molecules.

Glycosylation Bypass Strategies: Although challenging, approaches that bypass the need for MPDU1 in glycosylation pathways might be developed. This could involve alternative methods for mannose incorporation into glycan structures or modulation of downstream pathways.

Substrate Supplementation: Similar to approaches used in other glycosylation disorders, supplementation with specific sugars or metabolites might partially ameliorate the biochemical defect.

Treatment of Specific Manifestations: Organ-specific therapies addressing individual clinical manifestations (e.g., hepatic, cardiac, neurological) will remain important components of patient management.

How do different MPDU1 mutations affect protein function and correlate with disease severity?

Different mutations in MPDU1 appear to have varying impacts on protein function and consequent clinical severity. The p.Gly168Glu variant has been associated with a severe ciliopathy-like phenotype, suggesting this residue may be critical for MPDU1 function . Other reported mutations correlate with variable presentations of CDG-If.

To systematically investigate genotype-phenotype correlations, researchers should employ:

  • Functional Assays: Developing quantitative assays that measure MPDU1-dependent mannose-P-dolichol utilization would allow precise assessment of the functional impact of different mutations.

  • Structural Analysis: In silico modeling followed by experimental validation can help predict how specific mutations affect protein folding, stability, or interaction with binding partners.

  • Patient Registry Analysis: Collaborative international registries collecting genetic and phenotypic data would enable statistical analysis of genotype-phenotype correlations across larger patient populations.

  • Cell-Based Models: CRISPR/Cas9 gene editing to introduce specific mutations into cellular models would allow direct comparison of their functional consequences under controlled conditions.

  • Animal Models: Development of animal models carrying different MPDU1 mutations could provide insights into tissue-specific effects and developmental consequences of various mutations.

What role might MPDU1 play in cancer biology and tumor progression?

The observation that MPDU1 significantly influences cell adhesion properties and regulates key cell surface glycoproteins suggests potential roles in cancer biology. The Kato III cell line, derived from a gastric carcinoma, shows distinct growth patterns when MPDU1 function is restored . Furthermore, MPDU1 regulates expression of CEACAM-1, CEACAM-5, ADAM-15, TIMP-1, and Integrin B5 - all proteins with established roles in tumor biology .

Research methodologies to explore this connection should include:

  • Analysis of MPDU1 expression levels across cancer databases (TCGA, CCLE)

  • Correlation studies between MPDU1 expression and patient outcomes

  • In vivo xenograft studies comparing tumor growth and metastatic potential with and without MPDU1 expression

  • Investigation of how MPDU1-dependent glycosylation affects cancer-relevant receptor signaling pathways

How does MPDU1 deficiency specifically alter the glycosylation profile of the proteome?

While existing research has identified specific proteins affected by MPDU1 deficiency, comprehensive glycoproteomic analysis remains an important research direction. Such studies would involve:

  • Mass Spectrometry-Based Glycoproteomics: Comparison of glycopeptide profiles between MPDU1-proficient and deficient cells using techniques like hydrophilic interaction liquid chromatography coupled with mass spectrometry.

  • Site-Specific Glycosylation Analysis: Determination of how MPDU1 deficiency affects occupancy and glycan structure at specific N-glycosylation sites across the proteome.

  • Temporal Glycosylation Dynamics: Analysis of how MPDU1 influences glycosylation during cellular stress, differentiation, or response to stimuli.

  • Subcellular Compartment-Specific Effects: Investigation of whether MPDU1 deficiency differentially affects glycoproteins destined for specific subcellular compartments.

A methodological workflow would typically involve stable isotope labeling of cells, enrichment of glycopeptides, fractionation, and LC-MS/MS analysis, followed by computational integration of the data to generate a comprehensive map of altered glycosylation.

What is the evolutionary conservation of MPDU1 function across species?

Understanding the evolutionary conservation of MPDU1 provides insights into its fundamental biological importance. Comparative genomic approaches would involve:

  • Sequence alignment analysis across diverse organisms from yeast to mammals

  • Functional complementation studies testing whether MPDU1 orthologs from different species can rescue defects in human cells

  • Analysis of conserved protein domains and structural features

  • Examination of syntenic relationships and gene neighborhood across species

This evolutionary perspective can highlight the most critical functional domains of MPDU1 and potentially identify model organisms that might be particularly suitable for further functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.