Recombinant Human Mas-related G-protein coupled receptor member E (MRGPRE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its development for your order.
Synonyms
MRGPRE; GPR167; MRGE; Mas-related G-protein coupled receptor member E; G-protein coupled receptor 167
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEPREAGQHVGAANGAQEDVAFNLIILSLTEGLGLGGLLGNGAVLWLLSSNVYRNPFAIY LLDVACADLIFLGCHMVAIVPDLLQGRLDFPGFVQTSLATLRFFCYIVGLSLLAAVSVEQ CLAALFPAWYSCRRPRHLTTCVCALTWALCLLLHLLLSGACTQFFGEPSRHLCRTLWLVA AVLLALLCCTMCGASLMLLLRVERGPQRPPPRGFPGLILLTVLLFLFCGLPFGIYWLSRN LLWYIPHYFYHFSFLMAAVHCAAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRE TSRRGLVDIAA
Uniprot No.

Target Background

Function
Orphan receptor. May regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links

HGNC: 30694

OMIM: 607232

KEGG: hsa:116534

STRING: 9606.ENSP00000374482

UniGene: Hs.745512

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of human MRGPRE?

Human MRGPRE (MAS related GPR family member E) is located on chromosome 11 in the human genome. Specifically, it is found on the reference assembly GRCh38.p14 Primary Assembly (NC_000011.10) . Like other members of the MRGPR family, MRGPRE is structurally characterized as a G protein-coupled receptor with seven transmembrane domains. Understanding its genomic context is essential for designing primers for gene expression studies and for genetic manipulation experiments.

When analyzing the genomic sequence, researchers should:

  • Use the most updated reference sequence (currently GRCh38.p14)

  • Consider evolutionary conservation patterns when designing experiments

  • Account for potential splice variants in expression studies

How does MRGPRE expression differ from other MRGPR family members?

While specific MRGPRE expression patterns are still being fully characterized, it's important to understand the expression patterns of related MRGPR family members for comparative analysis. For instance, MRGPR-X1 is highly enriched in dorsal root ganglia (DRG) neurons . Recent research has also identified MRGPR-X1 expression in connective tissue mast cells and leukaemia-derived human mast cell lines (LAD-2) .

For effective MRGPRE expression studies:

  • Compare with established expression patterns of other MRGPR subtypes

  • Use multiple detection methods (qPCR, in situ hybridization, immunohistochemistry)

  • Account for potential species differences in expression profiles

What methodologies are most effective for studying MRGPRE signaling pathways?

Based on methodologies used for related receptors, effective approaches include:

  • Calcium signaling assays: Many MRGPR family members, including MRGPR-X1, signal through Gq pathways that mobilize calcium from intracellular stores . Techniques like FLIPR (Fluorescent Imaging Plate Reader) screening with GCaMP6s calcium indicators have been successfully employed for other MRGPR subtypes .

  • Reporter gene assays: For transcriptional responses, reporter constructs containing response elements like SRE (serum response elements) or NFAT (nuclear factors of activated T cells) can be effective, as demonstrated with MRGPR-X1 .

  • Electrophysiological methods: Whole-cell current clamp recordings can detect neuronal activation, as documented in studies of MRGPR-expressing DRG neurons .

How can researchers address species differences when modeling MRGPRE function?

Species differences represent a significant challenge in MRGPR research. For example, striking pharmacological differences have been observed between rodent and human MRGPR subtypes . When designing studies with MRGPRE:

  • Cross-species pharmacological profiling: Systematically test putative ligands across species orthologs to identify similarities and differences.

  • Humanized models: Consider developing knock-in models expressing human MRGPRE in rodent systems.

  • Primary human cell models: Where possible, validate findings in primary human cells expressing MRGPRE natively.

The following table summarizes observed species differences in ligand responses for related MRGPR subtypes:

LigandHuman MRGPR-X1Mouse MRGPR-CRat MRGPR-C
BAM8-22Full agonistFull agonistFull agonist
γ2-MSHNon-responsiveFull agonistFull agonist (more potent than BAM8-22)
Dynorphin-14Non-responsiveFull agonistNon-responsive
NPFF/NFAFNon-responsivePartial agonistNon-responsive

These differences highlight the importance of careful species consideration when extrapolating MRGPRE findings .

What are the most reliable experimental systems for functional characterization of MRGPRE?

Based on approaches used for related MRGPRs, consider these experimental systems:

  • HEK293 heterologous expression systems: These provide a clean background for initial pharmacological characterization, as successfully used for other MRGPR subtypes .

  • F11 cells: These DRG neuron-derived cells have shown similarity to cultured DRG neurons in multiple studies and might be valuable for MRGPRE research. They have been used successfully for studying MRGPR-X1 signaling and gene expression .

  • Primary cell cultures: When possible, primary cultures of cells naturally expressing MRGPRE provide the most physiologically relevant context, though identification of such cells may require additional research.

  • Considerations for each system:

    • Account for endogenous expression of signaling components

    • Validate with multiple independent expression systems

    • Ensure appropriate controls for transfection or transduction efficiency

How can researchers address potential functional redundancy between MRGPRE and other MRGPR family members?

The MRGPR family exhibits potential functional redundancy that complicates research interpretation. Strategies to address this include:

  • Selective pharmacological tools: Develop and validate highly selective ligands for MRGPRE versus other family members.

  • CRISPR/Cas9 gene editing: Generate selective knockout models to study MRGPRE in isolation.

  • Domain swapping experiments: Create chimeric receptors to identify unique functional regions of MRGPRE.

  • Systems biology approaches: Use network analysis to understand compensatory mechanisms and pathway crosstalk.

These approaches can help differentiate MRGPRE-specific functions from general MRGPR family functions.

What are the optimal methods for recombinant MRGPRE protein expression and purification?

For successful recombinant MRGPRE expression:

  • Expression systems:

    • HEK293 cells are commonly used for mammalian GPCR expression

    • Baculovirus-insect cell systems may provide higher yields

    • E. coli systems typically require significant optimization for GPCRs

  • Purification strategies:

    • Add affinity tags (His, FLAG) to N- or C-terminus (considering functional impact)

    • Include detergent screening to identify optimal solubilization conditions

    • Consider nanodiscs or other membrane-mimetic systems for maintaining native conformation

  • Quality control:

    • Verify protein folding using circular dichroism or fluorescence-based thermal stability assays

    • Confirm functionality through ligand binding assays

    • Assess homogeneity via size-exclusion chromatography

How should researchers design experiments to study MRGPRE signaling in the context of pain processing?

Given the role of related receptors like MRGPR-X1 in pain signaling , MRGPRE may have similar functions. Consider these experimental approaches:

  • Calcium imaging in DRG neurons: To detect acute activation and desensitization patterns.

  • Gene expression analysis: Focus on pain-related markers like:

    • Early growth response protein-1 (EGR-1)

    • Chemokine receptor 2 (CCR2)

    • Inflammatory cytokines

  • Behavioral models: If working with animal models, consider:

    • Mechanical and thermal sensitivity testing

    • Inflammatory pain models

    • Neuropathic pain models

  • Electrophysiology: Record responses before and after MRGPRE activation to detect:

    • Changes in action potential threshold

    • Alterations in voltage-gated calcium current

    • Modifications to other ion channel functions

What analytical methods are most appropriate for interpreting data from MRGPRE functional assays?

When analyzing MRGPRE functional data:

  • Pharmacological analysis:

    • Calculate EC50/IC50 values using three-parameter dose-response curves

    • Determine efficacy (Emax) relative to reference agonists

    • Assess receptor reserve through operational models

  • Statistical considerations:

    • Use paired t-tests for before/after comparisons

    • Apply ANOVA with appropriate post-hoc tests for multiple comparisons

    • Define center and dispersion measures clearly in reporting

  • Signaling pathway analysis:

    • Determine temporal dynamics of pathway activation

    • Assess crosstalk between parallel signaling cascades

    • Quantify downstream gene expression changes

How can researchers address the lack of validated MRGPRE-specific antibodies?

The challenge of antibody specificity is common in GPCR research. Consider these approaches:

  • Epitope tagging strategies:

    • Insert small epitope tags (HA, FLAG, myc) at receptor termini

    • Validate that tagging doesn't affect receptor function

    • Use well-characterized anti-tag antibodies

  • CRISPR/Cas9 knockin reporters:

    • Generate fluorescent protein fusions under endogenous promoter control

    • Use self-cleaving peptides to minimize functional disruption

    • Validate expression patterns through multiple approaches

  • mRNA detection alternatives:

    • Use RNAscope or similar highly specific in situ hybridization techniques

    • Validate with qPCR in sorted cell populations

    • Consider single-cell RNA sequencing approaches

How should researchers interpret contradictory findings related to MRGPRE function?

Given the limited data specifically on MRGPRE, contradictory findings may emerge. Address these with:

What are the most promising approaches for identifying specific MRGPRE ligands?

Ligand identification strategies include:

  • High-throughput screening:

    • Calcium mobilization assays in MRGPRE-expressing cells

    • β-arrestin recruitment assays

    • Label-free approaches measuring cellular impedance

  • In silico modeling:

    • Homology modeling based on related GPCR structures

    • Virtual screening of compound libraries

    • Molecular dynamics simulations of binding pocket flexibility

  • Deorphanization strategies:

    • Tissue extract fractionation and testing

    • Testing of known ligands for related receptors

    • Candidate approach based on expression pattern overlap

How might understanding MRGPRE function contribute to therapeutic development for pain and inflammatory conditions?

The therapeutic potential of MRGPRE research includes:

  • Novel analgesic development:

    • If MRGPRE resembles MRGPR-X1 in pain modulation

    • Potentially addressing pain types poorly managed by current therapeutics

    • Development of more selective compounds with fewer side effects

  • Inflammation control:

    • Targeting immune cell-expressed MRGPRE if present on relevant cell types

    • Modulating release of inflammatory mediators

    • Potential for tissue-specific anti-inflammatory effects

  • Biomarker development:

    • MRGPRE expression or activation as diagnostic indicators

    • Receptor polymorphisms as predictors of treatment response

    • Monitoring of receptor regulation in disease progression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.