Recombinant Human Mas-related G-protein coupled receptor member F (MRGPRF)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant MRGPRF is synthesized using various platforms to ensure proper folding and post-translational modifications:

Available Constructs (Cusabio)

CodeSpeciesExpression SystemRegion Expressed
CSB-CF822178HUHumanE. coliFull-length
CSB-YP822178HU1HumanYeastPartial (274-343)
CSB-CF844992MOMouseE. coliFull-length

These variants enable studies across species and experimental conditions.

Functional and Research Applications

Recombinant MRGPRF is critical for:

Cancer Biology

  • Tumor Suppression: Overexpression of MRGPRF inhibits melanoma cell proliferation, migration, and metastasis by blocking PI3K/Akt signaling. In vivo studies show reduced lung metastasis in melanoma models .

  • Mechanism: MRGPRF competes with p101 to bind p110γ, suppressing PIP3 generation and downstream oncogenic pathways .

Immune Regulation

  • Mast Cell Activation: MRGPRF’s paralog, MRGPRX2, mediates mast cell responses to bacterial peptides and drugs . While MRGPRF’s direct role is less defined, its structural homology suggests overlapping immune-modulatory functions.

Antibody Development

  • The monoclonal antibody MAB8396 (R&D Systems) targets MRGPRF (Met1-Ser343) and is validated for Western blot and flow cytometry .

Table: MRGPRF in Disease Models

Model SystemObservationCitation
Cutaneous MelanomaMRGPRF↓ correlates with advanced tumor stages and poor prognosis.
HEK293 CellsMRGPRF overexpression reduces PI3K/Akt signaling activity.
Bacterial ImmunityMRGPRX2 (paralog) detects quorum-sensing molecules to recruit neutrophils.

Challenges and Future Directions

  • Ligand Identification: MRGPRF remains an orphan receptor with no confirmed endogenous ligands.

  • Species Specificity: Murine and human MRGPRF share ~80% homology, enabling cross-species studies but requiring validation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
MRGPRF; GPR140; GPR168; MRGF; PSEC0142; Mas-related G-protein coupled receptor member F; Mas-related gene F protein; G-protein coupled receptor 140; G-protein coupled receptor 168
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLV GNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCR VLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNY FCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHV ILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ RLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
Uniprot No.

Target Background

Function
Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain.
Database Links

HGNC: 24828

OMIM: 607233

KEGG: hsa:116535

STRING: 9606.ENSP00000309782

UniGene: Hs.118513

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MRGPRF and what protein family does it belong to?

MRGPRF (MAS-related GPR, Member F), also known as RTA, MRGF, GPR140 or GPR168, belongs to the G protein coupled receptor 1 family. It is part of the broader MAS-related G-protein coupled receptor family, which includes several members with varied tissue expression patterns and functions. MRGPRF has been observed to undergo upregulation during the process of CSF-1 or GM-CSF-induced human monocyte to macrophage differentiation .

Unlike some related receptors such as MRGPRX2, which has been shown to interact with chemokines like CXCL14, the specific ligands and signaling pathways for MRGPRF remain less comprehensively characterized . The protein plays roles in cellular signaling cascades typical of G-protein coupled receptors, involving secondary messenger systems after ligand binding.

What are the optimal methods for detecting MRGPRF in tissue and cell samples?

Detection of MRGPRF in research settings can be accomplished through several validated methods:

  • Western Blot Analysis: Using specific antibodies such as Mouse Anti-Human MRGPRF Monoclonal Antibody, MRGPRF can be detected in tissue lysates. For example, in human uterus tissue, MRGPRF appears as a specific band at approximately 40 kDa when probed with 2 μg/mL of Mouse Anti-Human MRGPRF Monoclonal Antibody followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody .

  • Flow Cytometry: MRGPRF expression can be detected in transfected cell lines such as HEK293 human embryonic kidney cells using specific antibodies followed by fluorochrome-conjugated secondary antibodies. This approach allows for quantification of receptor expression at the cellular level .

  • Genetic Tracing: While not specifically demonstrated for MRGPRF in the provided sources, genetic tracing methods using Cre-dependent reporter systems have been successfully employed for related receptors like Mrgprd, suggesting similar approaches could be adapted for MRGPRF studies .

When setting up detection systems, researchers should conduct validation experiments to determine optimal antibody concentrations and experimental conditions for their specific sample types.

How should I design experiments to study MRGPRF function in cellular systems?

When designing experiments to investigate MRGPRF function, consider the following methodological approach:

  • Selection of appropriate cell models:

    • Cells naturally expressing MRGPRF (such as certain macrophage populations)

    • Recombinant expression systems (such as HEK293 cells transfected with human MRGPRF)

  • Experimental controls:

    • Negative controls: Non-transfected cells or cells transfected with empty vectors

    • Positive controls: Cells expressing well-characterized related receptors (e.g., MRGPRX2)

    • Irrelevant transfectants to establish specificity of observed effects

  • Functional readouts:

    • G-protein dependent signaling assays (calcium mobilization, cAMP production)

    • β-arrestin recruitment assays (as demonstrated for related receptors like MRGPRX2)

    • Receptor internalization studies

    • Downstream signaling pathway activation (phosphorylation of ERK, AKT, etc.)

  • Variable manipulation:

    • Dose-response relationships with potential ligands

    • Time-course experiments to capture temporal dynamics

    • Receptor mutagenesis to identify critical functional domains

What are the critical parameters to control when working with recombinant MRGPRF?

When working with recombinant MRGPRF, several critical parameters must be controlled:

  • Expression system selection:

    • Mammalian cell lines (e.g., HEK293) are often preferred for GPCR expression due to appropriate post-translational modifications

    • Consider inducible expression systems to control expression levels

  • Protein tagging considerations:

    • N-terminal tags may interfere with ligand binding

    • C-terminal tags may disrupt G-protein coupling

    • Use of small epitope tags (e.g., FLAG, HA) is preferable to larger protein tags

  • Storage and handling conditions:

    • For antibodies against MRGPRF: Store at -20 to -70°C for up to 12 months

    • After reconstitution: 2-8°C for 1 month under sterile conditions, or -20 to -70°C for 6 months

    • Avoid repeated freeze-thaw cycles

  • Transfection efficiency monitoring:

    • Co-transfection with reporter genes (e.g., eGFP) to visualize and quantify transfection success

    • Flow cytometric analysis to determine percentage of cells expressing the receptor

  • Receptor functionality verification:

    • Confirm proper membrane localization using cell surface biotinylation or immunofluorescence

    • Verify signal transduction capabilities using known GPCR activation assays

How does MRGPRF compare functionally to other MAS-related G-protein coupled receptors?

The MAS-related G-protein coupled receptor family includes multiple members with diverse functions:

ReceptorExpression PatternLigands/ActivatorsSignaling PathwaysPhysiological Roles
MRGPRFUpregulated during monocyte to macrophage differentiationNot fully characterizedG protein dependentUnder investigation
MRGPRX2Mast cells, upregulated in bronchial inflammationCXCL14 chemokine, C-terminal domain sequences of CXCL14G protein-dependent and β-arrestin recruitmentPotential role in idiopathic pulmonary fibrosis
MRGPRB2Mouse ortholog of MRGPRX2CXCL14Similar to MRGPRX2Mouse model studies
MrgprdNon-peptidergic nociceptorsNot specified in sourcesNot specified in sourcesPain sensing, shows somatotopic organization in central arbors

MRGPRF shows distinct tissue expression patterns compared to other family members. Unlike Mrgprd, which is specifically expressed in non-peptidergic nociceptors, MRGPRF appears to be associated with monocyte/macrophage lineages .

In terms of therapeutic potential, some MAS-related receptors like MRGPRX2 are being investigated as possible targets for conditions such as idiopathic pulmonary fibrosis based on their interaction with inflammatory chemokines such as CXCL14 . Similar investigations into MRGPRF's potential role in inflammation or other pathological conditions may yield valuable insights.

What are the experimental challenges in distinguishing MRGPRF function from other related receptors?

Researchers face several challenges when attempting to isolate and characterize MRGPRF function:

  • Receptor homology and cross-reactivity:

    • The MAS-related GPR family has multiple members with structural similarities

    • Antibodies may cross-react with related receptors, requiring thorough validation

    • Pharmacological tools may lack absolute specificity

  • Temporal expression dynamics:

    • As observed with related receptors like Mrgprd, expression patterns can change during development

    • Early embryonic expression may differ significantly from adult expression patterns

  • Methodological approaches to establish specificity:

    • Use of genetic knockout models to confirm antibody specificity

    • Employing inducible, temporally controlled recombination techniques

    • Double in situ hybridization to confirm co-expression patterns

  • Experimental verification strategies:

    • Sparse genetic labeling approaches to isolate specific receptor-expressing populations

    • Computational analysis to identify receptor-specific pharmacophoric sequences

    • Truncation and mutagenesis studies to map receptor-ligand interactions

When studying MRGPRF, researchers should employ multiple complementary techniques to overcome these challenges, such as combining genetic, pharmacological, and imaging approaches to build a comprehensive understanding of receptor function.

How can I optimize experimental design to investigate MRGPRF signaling pathways?

To effectively study MRGPRF signaling pathways, implement the following experimental design strategies:

  • Signal pathway identification:

    • Use phosphoprotein arrays to screen for activated pathways following receptor stimulation

    • Employ selective inhibitors of known G-protein coupled pathways (Gαs, Gαi/o, Gαq/11, Gα12/13)

    • Monitor second messengers including calcium, cAMP, and inositol phosphates

  • Pathway validation approaches:

    • siRNA or CRISPR-based knockdown/knockout of pathway components

    • Dominant negative mutants of signaling molecules

    • Constitutively active G-protein subunits to mimic receptor activation

  • Temporal dynamics analysis:

    • Real-time monitoring of signaling using FRET-based biosensors

    • Time-course experiments with multiple readout time points

    • Analysis of both immediate (seconds to minutes) and delayed (hours) responses

  • Biased signaling investigation:

    • Parallel assessment of G-protein versus β-arrestin recruitment (as demonstrated for MRGPRX2)

    • Comparative analysis of different ligand effects on pathway selection

    • Mutagenesis of receptor domains to identify regions controlling signaling bias

  • Data analysis considerations:

    • Apply appropriate statistical methods based on experimental design

    • For dose-response relationships, determine EC50/IC50 values and efficacy parameters

    • Consider computational models to integrate multiple signaling outputs

This systematic approach will help elucidate the specific signaling pathways engaged by MRGPRF and their biological consequences.

What tissues exhibit significant MRGPRF expression and how can this be accurately quantified?

Based on available research, MRGPRF expression has been documented in:

  • Immune cells:

    • Upregulated during CSF-1 or GM-CSF-induced human monocyte to macrophage differentiation

  • Reproductive tissues:

    • Detected in human uterus tissue via Western blot analysis

To accurately quantify MRGPRF expression across tissues and experimental conditions, researchers should consider these methodological approaches:

  • Quantitative expression analysis:

    • qRT-PCR with validated primer sets specific to MRGPRF

    • Digital droplet PCR for absolute quantification

    • RNAseq for transcriptome-wide expression analysis in context

  • Protein quantification methods:

    • Quantitative Western blot with standard curves

    • Flow cytometry with calibration beads to determine molecules of equivalent soluble fluorochrome (MESF)

    • ELISA or other immunoassays with recombinant standards

  • Single-cell analysis technologies:

    • Single-cell RNA sequencing to identify specific cell populations expressing MRGPRF

    • Mass cytometry (CyTOF) for high-dimensional protein analysis

    • Spatial transcriptomics to map expression within tissue architecture

  • Validation across expression systems:

    • Compare endogenous expression with recombinant systems

    • Evaluate effects of cell confluence, passage number, and culture conditions

    • Assess impact of inflammatory stimuli on expression levels

When quantifying MRGPRF expression, researchers should include appropriate housekeeping genes or proteins as internal controls and perform technical and biological replicates to ensure reproducibility of results.

How does MRGPRF expression change during cellular differentiation and what are the functional implications?

MRGPRF undergoes dynamic expression changes during cellular differentiation processes:

  • Monocyte to macrophage differentiation:

    • MRGPRF may be upregulated during CSF-1 or GM-CSF-induced human monocyte to macrophage differentiation

    • This suggests a potential role in macrophage function or phenotypic specialization

  • Experimental approaches to study differentiation-dependent expression:

    • Time-course analysis during differentiation protocols

    • Correlation of expression with established differentiation markers

    • Functional assays at different differentiation stages

    • Gain/loss of function experiments at critical differentiation timepoints

  • Potential functional implications:

    • Role in macrophage polarization (M1 vs. M2)

    • Involvement in tissue-resident macrophage specialization

    • Mediation of inflammatory responses or resolution

    • Contribution to phagocytic or secretory functions

To establish causality between MRGPRF expression changes and functional outcomes, researchers should design experiments with specific manipulation of MRGPRF levels (overexpression, knockdown, or knockout) at defined differentiation stages, followed by comprehensive phenotypic and functional assessments.

What is known about MRGPRF's role in disease states and how can this be further investigated?

While direct evidence for MRGPRF involvement in specific diseases is limited in the provided sources, related receptors offer insights into potential pathological relevance:

  • Potential disease associations based on expression pattern:

    • Given its expression in macrophages, MRGPRF may play roles in inflammatory or immune-mediated conditions

    • The detection in uterine tissue suggests possible involvement in reproductive pathologies

  • Disease connection of related receptors:

    • MRGPRX2 is upregulated in bronchial inflammation and potentially involved in idiopathic pulmonary fibrosis

    • This suggests exploration of MRGPRF in inflammatory lung conditions may be warranted

  • Experimental approaches to investigate disease relevance:

    • Analysis of MRGPRF expression in diseased versus healthy tissues

    • Correlation of expression levels with disease severity markers

    • Investigation of disease phenotypes in MRGPRF knockout models

    • Screening of patient cohorts for MRGPRF mutations or polymorphisms

  • Functional studies in disease models:

    • Use of relevant disease models (in vitro, ex vivo, and in vivo)

    • Pharmacological modulation of MRGPRF activity in disease settings

    • Assessment of downstream inflammatory mediators regulated by MRGPRF

Research into MRGPRF's role in pathological conditions should employ multiple complementary approaches, incorporating both clinical samples and experimental models to establish relevance to human disease.

What are the considerations for developing MRGPRF-targeted therapeutics based on current knowledge?

Development of MRGPRF-targeted therapeutics would require addressing several key considerations:

  • Receptor characterization requirements:

    • Full characterization of natural ligands and signaling pathways

    • Determination of three-dimensional receptor structure

    • Identification of key binding domains through mutagenesis studies

  • Therapeutic modality selection:

    • Small molecule agonists/antagonists

    • Peptide or protein-based therapeutics

    • Antibody-based approaches (similar to the development of therapeutic antibodies for other GPCRs)

  • Potential development pathway:

    • High-throughput screening for lead compounds

    • Structure-activity relationship studies

    • Computational modeling based on related receptors

    • Peptide truncation and optimization (as demonstrated for CXCL14 interaction with MRGPRX2)

  • Selectivity considerations:

    • Ensuring specificity against other MAS-related GPCRs

    • Screening against a panel of related receptors to confirm selectivity

    • Development of selective antagonists for MRGPRF versus related receptors

  • Translational challenges:

    • Differences between human MRGPRF and orthologs in model organisms

    • Identification of appropriate biomarkers for target engagement

    • Development of functional assays that correlate with therapeutic potential

The example of CXCL14 and MRGPRX2/B2 provides a potential template, where truncation combined with mutagenesis and computational studies identified pharmacophoric sequences that could be developed into therapeutics with similar or increased potency compared to the full-length protein .

What statistical approaches are most appropriate for analyzing data from MRGPRF experiments?

Selection of appropriate statistical methods depends on the experimental design and data characteristics:

  • For expression analysis across conditions:

    • t-tests or ANOVA for comparing expression levels between groups

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if normality assumptions are violated

    • Multiple comparison corrections (Bonferroni, False Discovery Rate) for large-scale analyses

  • For dose-response experiments:

    • Non-linear regression to determine EC50/IC50 values

    • Comparison of curve parameters (bottom, top, Hill slope) between conditions

    • Bootstrap analysis to determine confidence intervals for estimated parameters

  • For time-course experiments:

    • Repeated measures ANOVA or mixed-effects models

    • Area under the curve (AUC) analysis followed by appropriate comparisons

    • Time-series analysis for complex temporal patterns

  • For correlation with physiological or pathological parameters:

    • Pearson or Spearman correlation depending on data distribution

    • Multiple regression to account for confounding variables

    • Principal component analysis to handle multivariate data

  • Sample size and power considerations:

    • A priori power analysis to determine appropriate sample sizes

    • Post hoc power calculations to interpret negative results

    • Consideration of biological and technical replicates in experimental design

Each statistical approach should be selected based on specific experimental questions, with appropriate attention to assumptions underlying the methods and transparent reporting of all analytical decisions .

How can I integrate multiple experimental approaches to build a comprehensive understanding of MRGPRF function?

Building a comprehensive understanding of MRGPRF function requires integration of multiple experimental approaches:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Integrate receptor expression data with signaling pathway activation profiles

    • Map receptor-ligand interactions to downstream cellular responses

  • Computational modeling approaches:

    • Protein structure modeling based on related GPCRs

    • Molecular dynamics simulations of receptor-ligand interactions

    • Systems biology models of signaling networks

  • Cross-validation between techniques:

    • Verify findings using complementary methods (e.g., genetic and pharmacological approaches)

    • Compare results across different cell types and experimental systems

    • Validate in vitro findings in ex vivo or in vivo models

  • Temporal and spatial integration:

    • Study receptor function across different time scales (acute vs. chronic responses)

    • Examine expression and function across tissues and cell types

    • Consider developmental changes in receptor expression and function

  • Data visualization and integration tools:

    • Pathway mapping and enrichment analysis

    • Network visualization of protein-protein interactions

    • Machine learning approaches to identify patterns across diverse datasets

By systematically integrating diverse experimental approaches and datasets, researchers can develop a more complete understanding of MRGPRF biology, from molecular interactions to physiological significance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.