Recombinant Human Mas-related G-protein coupled receptor member G (MRGPRG)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human MRGPRG

Recombinant Human Mas-related G-protein coupled receptor member G (MRGPRG) is a synthetic version of the endogenous MRGPRG protein, expressed via heterologous systems (e.g., wheat germ, mammalian cells). It belongs to the MRGPR family of Class A GPCRs, which are primarily implicated in itch, pain, and immune responses. MRGPRG is an orphan receptor, with no identified endogenous ligands or well-characterized physiological functions.

Gene and Protein Details

ParameterDescription
GeneMRGPRG (GPR169, MRGG)
OrganismHomo sapiens
Protein Length~280 amino acids (sequence data available via GPCRdb)
Transmembrane Domains7 transmembrane (TM) helices, characteristic of Class A GPCRs
Extracellular MotifsShort N-terminus; conserved intracellular domains
Key Structural FeaturesLacks canonical GPCR motifs (e.g., CWxP, PIF, DRY) ; unique TM4-TM5 disulfide bond

MRGPRG’s sequence reveals conserved TM domains but diverges in extracellular regions, suggesting distinct ligand-binding potential . Structural models (e.g., 7TM diagrams) are inferred from homology to other MRGPRs but lack experimental validation .

Ligand and Signaling Pathways

CategoryDetails
Endogenous LigandsNone identified; classified as an orphan receptor
SignalingLikely involves G proteins (e.g., Gi, Gq), but data are limited
Agonists/AntagonistsNo small molecules or peptides reported; potential for synthetic ligands in research

MRGPRG’s orphan status contrasts with related receptors like MRGPRX2 (activated by β-defensins, LL-37) or MRGPRD (β-alanine) . Its expression in sensory neurons (e.g., dorsal root ganglia) suggests roles in nociception or itch, though direct evidence is absent .

Recombinant MRGPRG in Studies

ApplicationMethodOutcome
Expression SystemsWheat germ, HEK293 cells High-yield recombinant protein production for structural/biochemical assays
Functional AssaysCalcium mobilization, cAMP/ERK signalingLimited due to lack of agonists; requires ligand discovery efforts
Therapeutic PotentialTarget for itch/pain modulationHypothetical; no validated drug candidates reported

Recombinant MRGPRG is primarily used in in vitro studies to study receptor folding, trafficking, or interactions with G proteins. For example, flow cytometry and ELISA/Western blotting (as seen in MRGPRX2 studies) could be adapted for MRGPRG .

Comparative Analysis with Other MRGPRs

ReceptorLigandsPrimary FunctionsExpression
MRGPRX2β-defensins, LL-37, vancomycinMast cell degranulation, pseudo-allergic reactionsMast cells, connective tissue
MRGPRDβ-alanineItch, nociceptionDorsal root ganglia (DRG)
MRGPRGNone identifiedHypothetical (nociception/itch)DRG, sensory neurons (inferred)

MRGPRG shares structural homology with MRGPRD and MRGPRX2 but lacks their ligand specificity. Unlike MRGPRX2 (primarily mast cell-associated), MRGPRG may function in neuronal sensory pathways .

Future Directions and Challenges

  1. Ligand Discovery: High-throughput screening for small molecules or peptides that activate MRGPRG.

  2. Structural Studies: Cryo-EM or X-ray crystallography to resolve receptor conformations (e.g., active vs. inactive states).

  3. Functional Validation: Knockout models to assess roles in itch, pain, or inflammation.

  4. Therapeutic Targets: Exploring MRGPRG as a target for chronic itch or neuropathic pain, pending ligand availability.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRGPRG; GPR169; MRGG; Mas-related G-protein coupled receptor member G; G-protein coupled receptor 169
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MFGLFGLWRTFDSVVFYLTLIVGLGGPVGNGLVLWNLGFRIKKGPFSIYLLHLAAADFLF LSCRVGFSVAQAALGAQDTLYFVLTFLWFAVGLWLLAAFSVERCLSDLFPACYQGCRPRH ASAVLCALVWTPTLPAVPLPANACGLLRNSACPLVCPRYHVASVTWFLVLARVAWTAGVV LFVWVTCCSTRPRPRLYGIVLGALLLLFFCGLPSVFYWSLQPLLNFLLPVFSPLATLLAC VNSSSKPLIYSGLGRQPGKREPLRSVLRRALGEGAELGARGQSLPMGLL
Uniprot No.

Target Background

Function

Background and Function: MRGPRG is an orphan G-protein coupled receptor. It is implicated in the regulation of nociceptor function and/or development, potentially influencing pain sensation and modulation.

Database Links

HGNC: 24829

OMIM: 607234

KEGG: hsa:386746

STRING: 9606.ENSP00000330612

UniGene: Hs.730306

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of MRGPRG and how does it differ from canonical GPCRs?

MRGPRG, like other members of the MRGPR family, possesses distinctive structural features that differentiate it from canonical G protein-coupled receptors. Most notably, MRGPRs lack several conserved motifs typically essential for GPCR activation, including the CWxP motif, PIF motif, and the semi-conserved DRY motif .

Key structural characteristics include:

  • A unique TM4-TM5 disulfide bond instead of the TM3-ECL2 disulfide bond observed in other family A GPCRs

  • Replacement of the conserved W6.48 in the CWxP motif with G6.48 or S6.48, resulting in closer interaction between TM6 and TM3

  • A shallow, solvent-exposed ligand binding pocket that differs significantly from the deeper orthosteric pockets of canonical GPCRs

  • An unusual TM6 kink below the ligand pocket, partially stabilized by hydrogen bonding between Y3.36 and G/S6.48

MRGPRG specifically contains alanine at position 34.51, suggesting it may not primarily utilize Gq protein for signaling, unlike some other family members .

What are the recommended expression systems for producing functional recombinant human MRGPRG?

Producing functional recombinant human MRGPRG requires careful consideration of expression systems:

  • Mammalian expression systems (HEK293 or CHO cells) provide the most physiologically relevant post-translational modifications and signaling machinery for functional studies.

  • Bacterial Artificial Chromosome (BAC) approach allows expression of human MRGPRG in transgenic mouse models, similar to methods successfully used for MRGPRX1 .

  • Drug screening considerations:

    • When conducting pharmacological screens, include the permissive G15 protein, which facilitates coupling to multiple GPCRs and enables Ca²⁺ flux assays even for receptors not primarily signaling through Gq

    • Design constructs with epitope tags for detection and purification purposes

    • Consider codon optimization for improved expression levels

For humanized mouse models, the receptor can be expressed under the control of mouse ortholog promoters to maintain appropriate tissue-specific expression patterns .

What signaling pathways should researchers investigate when characterizing MRGPRG function?

When characterizing MRGPRG signaling, researchers should examine multiple pathways due to the complex signaling profiles of MRGPR family receptors:

  • G protein coupling analysis:

    • Though MRGPRG may have reduced Gq signaling due to alanine at position 34.51, assess multiple G protein subtypes (Gi, Gq/11, Gs, G12/13)

    • Use bioluminescence resonance energy transfer (BRET)-based G protein heterotrimer dissociation assays to comprehensively profile coupling preferences

  • Downstream effector modulation:

    • Evaluate calcium mobilization for potential Gq activity

    • Measure cAMP production/inhibition for Gs/Gi activity

    • Assess modulation of ion channels, particularly TRP channels and N-type HVA calcium channels, which are regulated by several MRGPRs through Gβγ-dependent mechanisms

  • Receptor activation dynamics:

    • Investigate potential conformational changes upon agonist binding, including inward movement of TM6 and changes in extracellular loops

    • Consider potential biased signaling where different ligands might preferentially activate distinct pathways

How should researchers design humanized mouse models for studying human MRGPRG in vivo?

Creating valid humanized mouse models for MRGPRG research requires strategic genetic approaches:

  • BAC transgenic approach methodology:

    • Design a construct where human MRGPRG expression is driven by the mouse ortholog promoter to maintain appropriate expression patterns

    • Consider incorporating reporter elements (such as GFP-Cre) to identify neurons expressing the transgene for cellular recording via intrinsic fluorescence

    • Cross the transgenic line with Mrgpr-cluster knockout mice to eliminate potential interference from endogenous receptors

  • Validation requirements:

    • Confirm appropriate tissue-restricted expression through immunohistochemistry and in situ hybridization

    • Verify functional receptor expression through calcium imaging in isolated DRG neurons

    • Assess responsiveness to potential MRGPRG ligands compared to wild-type controls

  • Experimental design for pain studies:

    • Test potential analgesic effects in inflammatory pain models using Complete Freund's Adjuvant (CFA) (50% solution injected subcutaneously into the hind paw)

    • Evaluate efficacy in neuropathic pain using Chronic Constriction Injury (CCI) of the sciatic nerve

    • Measure both evoked pain behaviors and spontaneous pain indicators

What structural biology approaches are most promising for elucidating MRGPRG binding sites?

Recent structural advances with related MRGPRs provide templates for MRGPRG structural biology:

  • Recommended techniques:

    • Cryogenic electron microscopy (cryoEM) has been successfully used to determine structures of MRGPRX2, MRGPRX4, MRGPRD, and MRGPRX1

    • Aim to capture multiple conformational states: ligand-bound, G protein-complexed, and potentially inactive states

    • Cross-validate findings with complementary approaches such as hydrogen-deuterium exchange mass spectrometry

  • Structural stabilization strategies:

    • The unique structural features of MRGPRs (such as the TM4-TM5 disulfide bond and unusual TM6 kink) should be preserved during preparation

    • Consider co-crystallization with stabilizing antibody fragments or nanobodies

    • Incorporate known ligands or stable analogs to stabilize active conformations

  • Key structural elements to investigate:

    • The shallow, solvent-exposed ligand binding pocket characteristic of MRGPRs

    • The hydrogen bond between Y3.36 and G/S6.48 that stabilizes the TM6 kink

    • Potential allosteric binding sites that might be exploited for drug discovery

Understanding these structural elements could facilitate structure-based drug discovery and explain MRGPRG's unique pharmacological properties .

What methodological approaches are recommended for identifying selective MRGPRG ligands?

Developing selective MRGPRG ligands presents unique challenges requiring systematic approaches:

  • High-throughput screening design:

    • Utilize the permissive G15 protein for initial Ca²⁺ flux screening even though MRGPRG may not primarily signal through Gq

    • Screen diverse chemical libraries including peptides, small molecules, and natural products

    • Implement counter-screening against related MRGPR subtypes to identify selective compounds

  • Structure-guided approaches:

    • Leverage structural insights from related MRGPRs to model the MRGPRG binding pocket

    • Consider the shallow, solvent-exposed pocket characteristic of MRGPRs when designing potential ligands

    • Focus on understanding the diverse ligand recognition motifs present across MRGPRs

  • Functional validation cascade:

    • Confirm binding through direct binding assays where possible

    • Evaluate activity across multiple signaling pathways to identify potential biased ligands

    • Test candidate ligands in humanized mouse models to verify in vivo activity

  • Positive allosteric modulators (PAMs):

    • Consider developing PAMs similar to ML382 used for MRGPRX1, which enhanced agonist effects on calcium channel inhibition and spinal nociceptive transmission

    • PAMs may provide greater specificity and reduced side effects compared to direct agonists

How can researchers differentiate between MRGPRG effects and other MRGPR family members in sensory neurons?

Ensuring specificity in MRGPRG studies requires rigorous experimental controls:

  • Genetic approaches:

    • Generate MRGPRG-specific knockout controls

    • Use humanized mouse models expressing only human MRGPRG on a Mrgpr-cluster knockout background

    • Implement siRNA knockdown in cultured neurons as a complementary approach

  • Pharmacological strategies:

    • Develop a panel of ligands with differential selectivity profiles across MRGPR family members

    • Include appropriate negative control compounds with similar structures but lacking MRGPRG activity

    • Establish comprehensive dose-response relationships across MRGPR subtypes

  • Expression analysis:

    • Utilize single-cell RNA sequencing to identify neurons expressing MRGPRG versus other family members

    • Employ subtype-specific antibodies for immunohistochemical identification

    • Use reporter-tagged models to visualize expression patterns

  • Functional discrimination:

    • Compare electrophysiological responses to MRGPRG activation versus other family members

    • Examine potential differences in downstream signaling pathways and physiological outcomes

    • Consider temporal dynamics of responses for differentiation

What are the recommended protocols for studying MRGPRG involvement in pain modulation?

Investigating MRGPRG's role in pain modulation requires multi-level experimental approaches:

  • Cellular assays:

    • Patch-clamp recordings to assess inhibition of high-voltage-activated (HVA) Ca²⁺ channels, a key mechanism for pain inhibition by MRGPRs

    • Spinal cord slice electrophysiology to evaluate attenuation of spinal nociceptive transmission

    • Calcium imaging in dissociated DRG neurons to characterize neuronal responses

  • In vivo pain models:

    • Inflammatory pain: Complete Freund's Adjuvant (CFA) model with 50% solution injected subcutaneously into the hind paw

    • Neuropathic pain: Chronic Constriction Injury (CCI) of the sciatic nerve

    • Measure both evoked pain (mechanical, thermal hypersensitivity) and spontaneous pain behaviors

  • Outcome assessment:

    • Mechanical sensitivity: von Frey filament testing

    • Thermal sensitivity: Hargreaves or hot plate tests

    • Spontaneous pain behaviors: grimace scales, weight bearing, conditioned place preference

    • Monitor for potential side effects on locomotion, body temperature, and other physiological parameters

  • Data analysis considerations:

    • Compare efficacy of MRGPRG ligands to standard analgesics

    • Evaluate time course of effects

    • Assess sex differences in responses

    • Consider potential differences between acute administration and chronic treatment

What approaches should be used to analyze MRGPRG polymorphisms and their functional significance?

MRGPR family receptors display high sequence diversity and numerous polymorphisms in humans . For MRGPRG variants:

  • Identification strategies:

    • Conduct targeted sequencing of MRGPRG in diverse human populations

    • Analyze existing genomic databases for non-synonymous variants

    • Focus on polymorphisms in functionally critical regions (ligand binding pocket, G protein interface)

  • Functional characterization methodology:

    • Generate recombinant receptors containing identified variants

    • Compare signaling profiles across multiple pathways (Gi, Gq, G12/13)

    • Assess cell surface expression levels and trafficking

    • Evaluate ligand binding affinities and functional potencies

    • Test potential changes in receptor activation kinetics

  • Structural mapping:

    • Map polymorphisms onto homology models based on related MRGPR structures

    • Prioritize variants likely to impact ligand binding, G protein coupling, or receptor stability

    • Use molecular dynamics simulations to predict functional consequences

  • Clinical correlations:

    • Where possible, correlate MRGPRG variants with individual differences in pain sensitivity

    • Analyze potential associations with response to analgesic treatments

How might species differences in MRGPRG affect translation from animal models to humans?

MRGPRs display high sequence diversity across species , presenting translational challenges:

  • Comparative analysis approach:

    SpeciesSequence HomologyLigand RecognitionSignaling PathwaysExpression Pattern
    Human MRGPRGReferenceMay recognize species-specific ligandsPotentially less Gq dependent due to alanine at 34.51 Sensory neurons
    Mouse orthologLikely moderateMay differ from human receptorMay have different G protein couplingSimilar but not identical
    Rat orthologLikely moderateMay differ from human receptorMay have different G protein couplingSimilar but not identical
  • Translational considerations:

    • Human-selective compounds may not activate rodent orthologs, necessitating humanized models

    • Pharmacokinetic/pharmacodynamic properties may differ between species

    • Pain mechanisms have both conserved and species-specific components

  • Mitigation strategies:

    • Develop humanized mouse models expressing human MRGPRG under control of mouse ortholog promoters

    • Use in vitro assays with both human and rodent receptors to identify species-selective versus conserved activities

    • Consider non-human primate models for advanced translational studies of promising compounds

What are the critical quality control measures for recombinant MRGPRG expression and purification?

Ensuring high-quality recombinant MRGPRG is essential for reliable experimental results:

How should researchers troubleshoot inconsistent results in MRGPRG signaling assays?

MRGPR signaling can be complex due to promiscuous coupling and various downstream effectors :

  • Assay optimization considerations:

    • Verify receptor expression levels before each experiment

    • Establish optimal cell density and assay timing parameters

    • Ensure appropriate positive and negative controls are included

    • Use multiple independent assay methods to confirm findings

  • Signal detection optimization:

    • For potential Gi coupling: measure inhibition of forskolin-stimulated cAMP

    • For potentially limited Gq signaling (due to alanine at 34.51) : augment with promiscuous G15 protein

    • For detecting Gβγ-mediated effects: examine modulation of ion channels

    • Consider receptor reserve effects when interpreting concentration-response data

  • Troubleshooting guide:

    ProblemPotential CausesSolutions
    No response to putative ligandsImproper receptor expression; inactive ligand; wrong signaling readoutVerify receptor expression; test positive control ligand; try alternative signaling assays
    High basal activityConstitutive activity; overexpression artifactsInclude inverse agonist controls; reduce expression levels; use inducible expression systems
    Poor signal-to-noise ratioSuboptimal assay conditions; low coupling efficiencyOptimize cell density and assay timing; enhance coupling with chimeric/promiscuous G proteins
    Inconsistent results between experimentsVariable receptor expression; different cell passage numbersStandardize expression levels; establish maximum passage limits; create frozen cell stocks

What are the most promising applications of MRGPRG as a potential therapeutic target?

Based on the characteristics of MRGPR family receptors, MRGPRG presents several promising therapeutic opportunities:

  • Potential clinical applications:

    • Treatment of chronic pain conditions, particularly neuropathic pain resulting from nerve injury

    • Management of inflammatory pain states

    • Potential applications in pruritus (itch) based on the role of other MRGPRs in itch sensation

    • Alternative to opioid analgesics with potentially fewer side effects

  • Therapeutic modality options:

    • Direct agonists that activate the receptor

    • Positive allosteric modulators (PAMs) that enhance activation by endogenous ligands

    • Biased agonists that selectively activate analgesic signaling pathways

    • Combination approaches targeting multiple MRGPR family members

  • Advantages of MRGPRG as a target:

    • Restricted expression primarily in sensory neurons, limiting potential off-target effects

    • Involvement in modulation of pain-relevant signaling pathways

    • Potential to achieve analgesia without significant central nervous system effects

Experience with related receptors such as MRGPRX1 demonstrates that both direct agonists (like BAM8-22) and PAMs (like ML382) can effectively attenuate various pain modalities without causing obvious side effects .

What are the key unresolved questions regarding MRGPRG biology and pharmacology?

Several critical knowledge gaps require further investigation:

  • Fundamental biology questions:

    • What are the endogenous ligands for MRGPRG?

    • What is the precise expression pattern of MRGPRG in human tissues?

    • How does MRGPRG signaling integrate with other pain modulatory systems?

    • What are the specific roles of MRGPRG versus other MRGPR family members in pain processing?

  • Structural and pharmacological uncertainties:

    • What are the unique structural features of MRGPRG compared to other family members?

    • How does the alanine at position 34.51 affect signaling bias and ligand responses?

    • What determines ligand selectivity across MRGPR family members?

    • Are there potential allosteric binding sites that could be targeted for drug development?

  • Translational challenges:

    • How do species differences affect translation from preclinical models to humans?

    • What biomarkers would indicate successful MRGPRG engagement in clinical settings?

    • Would tolerance develop to MRGPRG-targeted therapies during chronic administration?

    • How might MRGPRG-targeted therapies interact with existing pain management approaches?

Addressing these questions will require integrated approaches combining structural biology, molecular pharmacology, and in vivo models, including humanized mouse systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.