Recombinant Human Mas-related G-protein coupled receptor MRG (MAS1L)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Mas-related G-protein coupled receptor MRG (MAS1L) is a synthetically produced protein belonging to the G-protein coupled receptor (GPCR) 1 family, specifically within the Mas subfamily . Encoded by the MAS1L gene (NCBI Gene ID: 116511), this receptor plays roles in nociception, neuropathic pain, and sensory neuron function . The recombinant form enables mechanistic studies and therapeutic development for conditions like diabetic neuropathy and chronic pain .

Key Sequence Features

DomainResiduesFunction
Transmembrane 170–90Ligand binding and signal transduction
ECL2210–220Critical for ligand specificity
C-terminal340–378G-protein coupling and regulation

Experimental Uses

  • Pain Mechanisms: Used to study neuropathic pain in diabetic mouse models, where MAS1L upregulation in dorsal root ganglion (DRG) neurons correlates with mechanical allodynia .

  • Mast Cell Activation: Investigates itch and inflammation via Mrgpr signaling pathways .

  • Drug Discovery: Serves as a target for developing analgesics, with studies highlighting its inhibition of high-voltage-activated calcium channels in nociceptors .

Table 1: Key Applications

ApplicationModel SystemOutcomeSource
Neuropathic pain analysisHFD diabetic miceMAS1L activation increases DRG neuron excitability
Calcium channel modulationHEK-293 cellsInhibits Ca²⁺ influx via Gαi/o signaling

Production and Quality Control

  • Expression System: E. coli .

  • Purification: Protein A or immobilized metal affinity chromatography (IMAC) for His-tagged variants .

  • Purity: >90% by SDS-PAGE .

  • Storage: Lyophilized or in PBS/glycerol at -80°C .

Table 2: Physical Properties

PropertyDetail
Molecular Weight42 kDa (observed)
Isoelectric PointPredicted 8.9 (UniProt P35410)
StabilitySensitive to repeated freeze-thaw cycles

Antibodies and Controls

  • Anti-MAS1L Antibodies: Validated for WB (1:2,000–1:10,000 dilution), ELISA, and IHC .

    • Clone 85003-1-RR: Reacts with human and mouse samples .

    • PA5-97954 (Thermo Fisher): Targets extracellular ECL2 residues .

  • Control Fragments: Recombinant MAS1L (aa 6–79) used to block antibody binding in validation assays .

Role in Neuropathic Pain

  • Diabetic Neuropathy: Single-cell RNA sequencing revealed MAS1L overexpression in DRG neurons of high-fat diet (HFD) mice, correlating with mechanical allodynia .

  • Calcium Signaling: MAS1L activation enhances intracellular Ca²⁺ influx in DRG neurons, driving hyperexcitability .

Therapeutic Potential

  • Agonists/PAMs: Compounds like ML382 (positive allosteric modulator) attenuate neuropathic pain in humanized MrgprX1 mice without off-target effects .

Future Directions

MAS1L’s restricted expression in nociceptors positions it as a promising target for precision analgesics . Ongoing research aims to:

  1. Develop subtype-specific agonists to minimize side effects.

  2. Explore gene therapy for chronic pain management.

  3. Validate biomarkers for MAS1L-associated pathologies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MAS1L; MRG; Mas-related G-protein coupled receptor MRG; MAS-R; MAS1-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETI HMQMSMAVGQQALPLNIIAPKAVLVSLCGVLLNGTVFWLLCCGATNPYMVYILHLVAADV IYLCCSAVGFLQVTLLTYHGVVFFIPDFLAILSPFSFEVCLCLLVAISTERCVCVLFPIW YRCHRPKYTSNVVCTLIWGLPFCINIVKSLFLTYWKHVKACVIFLKLSGLFHAILSLVMC VSSLTLLIRFLCCSQQQKATRVYAVVQISAPMFLLWALPLSVAPLITDFKMFVTTSYLIS LFLIINSSANPIIYFFVGSLRKKRLKESLRVILQRALADKPEVGRNKKAAGIDPMEQPHS TQHVENLLPREHRVDVET
Uniprot No.

Target Background

Gene References Into Functions
  1. Mas, MrgD, and MRG mediate Ang IV-stimulated AA release, with the highest activity observed for Mas. While Ang III activated Mas and MrgX2, Ang II stimulated AA release through Mas and MRG. PMID: 18636314
Database Links

HGNC: 13961

OMIM: 607235

KEGG: hsa:116511

STRING: 9606.ENSP00000366331

UniGene: Hs.533297

Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is MAS1L and what are its basic characteristics?

    MAS1L (also known as MRG, Mas-related G-protein coupled receptor MRG, or MAS-R) is a G-protein coupled receptor expressed in specific cell populations. This receptor has a predicted molecular weight of approximately 42 kDa based on Western blot analysis . MAS1L belongs to the Mas-related GPCR family and shares structural similarities with other family members. The receptor contains multiple transmembrane domains characteristic of GPCRs and has specific ligand binding properties that distinguish it from related receptors. Current evidence indicates that MAS1L responds to stimulation by angiotensin metabolites , suggesting its potential role in angiotensin-related signaling pathways.

  • Where is MAS1L predominantly expressed in human tissues?

    MAS1L expression follows a restricted pattern, making it an interesting target for tissue-specific research. Based on available evidence, MAS1L shares expression similarities with MRGPRX1, which shows restricted expression in subsets of primary nociceptive neurons within the peripheral nervous system . This localized expression pattern is particularly relevant for pain research, as it suggests potential involvement in nociceptive pathways. The receptor appears to be expressed in small-diameter sensory neurons in dorsal root ganglia (DRG) and trigeminal ganglia, similar to other MRG family members. This restricted expression pattern makes MAS1L a promising target for therapeutic interventions aimed at modulating pain pathways with potentially fewer off-target effects.

  • What methodologies are available for detecting MAS1L expression?

    Several methodologies can be employed to detect MAS1L expression across experimental contexts:

    • Western Blot Analysis: Commercially available antibodies such as rabbit polyclonal MAS1L antibodies have been validated for Western blot analysis in human, mouse, and rat samples . These antibodies have been successfully used with whole cell lysates from HEK293T, NIH3T3, and PC12 cell lines.

    • Immunohistochemistry/Immunofluorescence: While not explicitly mentioned in the search results, standard IHC/IF protocols with validated antibodies would be applicable for tissue localization studies.

    • RT-PCR/qPCR: RNA expression can be quantified through standard molecular biology techniques.

    • RNA-Seq: For comprehensive transcriptomic profiling.

    When selecting detection methodologies, researchers should consider tissue-specific expression patterns and potential cross-reactivity with related MRG family members.

  • What animal models are suitable for studying MAS1L function?

    Developing appropriate animal models for MAS1L research requires careful consideration of species differences. A significant challenge in MAS1L research is the species-specific differences across the MRG family. Researchers have addressed this limitation by generating humanized mouse models:

    • Transgenic Humanized Mouse Model: A bacterial artificial chromosome (BAC) transgenic mouse line has been created where human MRGPRX1 (related to MAS1L) expression is driven by the mouse MrgprC11 promoter . This model enables the testing of human receptor-specific compounds in vivo.

    • Limitations of Standard Models: It's important to note that many agonists developed for human MAS1L/MRGPRX1 do not activate the rodent homologs due to significant species differences . This limitation must be considered when designing studies using standard rodent models.

    These transgenic models provide valuable platforms for in vivo functional studies and drug development efforts targeting the human receptor.

  • What are the challenges in validating antibody specificity for MAS1L research?

    Ensuring antibody specificity is critical for reliable MAS1L detection. Researchers should implement the following validation approaches:

    • Multiple Detection Methods: Confirm expression using complementary techniques (Western blot, immunohistochemistry, and PCR).

    • Positive and Negative Controls: Include appropriate controls, such as recombinant protein or cells with confirmed expression (HEK293T, NIH3T3, PC12) and negative control tissues or knockdown/knockout samples.

    • Blocking Peptides: Use immunizing peptides to confirm antibody specificity.

    • Cross-Reactivity Testing: Evaluate potential cross-reactivity with related MRG family members, particularly when studying tissues expressing multiple family members.

    • Knockout Validation: When available, use knockout models or CRISPR-edited cells lacking MAS1L expression.

    The commercial antibodies currently available, such as ab200685, have been validated for Western blot analysis in specific cell types , but researchers should perform additional validation steps when applying these antibodies to new experimental systems.

Advanced Research Questions

  • How do genetic polymorphisms in MAS1L contribute to disease susceptibility?

    Genetic polymorphisms in the MAS1L genomic region have been associated with significant disease risks, particularly in the context of autoimmune disorders:

    • Type 1A Diabetes Association: Single nucleotide polymorphisms (SNPs) in the UBD/MAS1L region have been identified through extensive SNP analysis of extended MHC regions. A significant association has been found (rs1233478, P = 1.6 × 10^-23, allelic odds ratio 2.0) .

    • Independence from HLA Factors: Importantly, this association remains significant even after adjustment for known HLA risk factors (HLA-DRB1, HLA-DQB1, HLA-B, and HLA-A) with P = 0.01 . This suggests MAS1L polymorphisms contribute additional risk beyond classical HLA associations.

    • 8.1 Haplotype Analysis: Research has observed over 99% conservation for up to 9 million nucleotides between chromosomes containing a common haplotype with the HLA-DRB103, HLA-B08, and HLA-A*01 alleles (termed the "8.1 haplotype") . The diabetes association in the UBD/MAS1L region remained significant even after chromosomes with the 8.1 haplotype were removed (rs1233478, P = 1.4 × 10^-12) .

    These findings suggest that investigating MAS1L polymorphisms may provide insights into the genetic basis of autoimmune diseases and identify potential therapeutic targets.

  • What methodologies can be employed to investigate allelic imbalance in MAS1L expression?

    Investigating allelic imbalance in MAS1L expression requires sophisticated statistical frameworks and experimental approaches:

    • MIXALIME Framework: This computational framework enables calling allele-specific variants in diverse omics data. It incorporates statistical models that account for read mapping bias and copy number variation .

    • Statistical Models: Several statistical models can be applied based on the experimental context:

      • Beta-binomial model: Offers high specificity with modest sensitivity

      • Beta negative binomial (BetaNB) model: Identifies more allele-specific variants with minor loss of specificity

      • Negative binomial (NB) model: Prioritizes sensitivity over specificity

      • Mixture Component Negative Binomial (MCNB) model: Provides balanced sensitivity and specificity

    • Experimental Approaches: Researchers can use:

      • DNase-Seq, ATAC-Seq, or CAGE-Seq to gather data on chromatin accessibility

      • RNA-Seq for transcriptomic profiling

      • ChIP-Seq for protein-DNA interactions

    The choice of statistical model depends on sample size and experiment goals. For larger aggregations across multiple samples or replicates, strict BetaNB models are effective; with fewer samples, more permissive models like NB may be preferable .

  • What signaling pathways are activated by MAS1L and how do they differ from related receptors?

    MAS1L activates specific downstream signaling pathways that distinguish it from related receptors:

    • G-protein Coupling: Evidence suggests MAS1L, similar to MRGPRX1, signals through G-protein coupled pathways. MRGPRX1 activation leads to inhibition of high-voltage-activated (HVA) calcium currents primarily through G i/o-sensitive G βγ binding, which may also involve G βγ-independent pathways .

    • Calcium Channel Modulation: An important function of MAS1L/MRGPRX1 appears to be modulation of high-voltage-activated calcium channels in primary nociceptive neurons. This mechanism shares similarities with opioid inhibition of pain through the G i/o pathway .

    • Comparison with Related Receptors: While MRGPRX1 and mouse MRGPRC11 share 54% amino acid identity, they exhibit considerably different drug profiles . Additionally, MRGPRC inhibits HVA calcium currents through a phospholipase C-dependent mechanism, whereas MRGPRX1 primarily utilizes G i/o-sensitive pathways .

    • Unique Ligand Specificity: MAS1L responds to angiotensin metabolites , indicating specific ligand recognition properties that may differ from related receptors.

    Understanding these pathway differences is essential for developing receptor-specific therapeutic agents and interpreting experimental results correctly.

  • How can MAS1L be targeted for pain management therapeutics?

    MAS1L/MRGPRX1 represents a promising target for novel pain inhibitors due to several advantageous characteristics:

    • Restricted Expression: The restricted expression of MRGPRX1 in nociceptive neurons within the peripheral nervous system makes it an ideal target for pain-specific interventions with potentially fewer side effects compared to current analgesics .

    • Therapeutic Approaches: Two main therapeutic strategies have shown promise:

      1. Receptor Agonists: Direct agonists like BAM8-22 (bovine adrenal medulla 8-22) effectively attenuate evoked, persistent, and spontaneous pain without obvious side effects in humanized mouse models .

      2. Positive Allosteric Modulators (PAMs): Compounds like ML382 enhance the effects of endogenous or exogenous agonists. Importantly, ML382 alone attenuated both evoked pain hypersensitivity and spontaneous pain in MrgprX1 mice after nerve injury without requiring co-administration of an exogenous agonist .

    • Cellular Mechanisms: These compounds inhibit high-voltage-activated calcium channels in nociceptive neurons and attenuate spinal nociceptive transmission .

    • Testing Challenges: Due to species differences, humanized mouse models expressing MRGPRX1 in native nociceptive neurons are necessary to examine receptor functions and develop therapeutic agents for human application .

    These findings suggest that both agonists and PAMs targeting MAS1L/MRGPRX1 represent promising novel drug candidates for managing persistent pain conditions with potentially improved side effect profiles.

  • What experimental considerations are critical when designing functional assays for MAS1L?

    Designing effective functional assays for MAS1L requires attention to several critical factors:

    • Species-Specific Differences: Due to significant species differences across the MRG family, many compounds targeting human MAS1L/MRGPRX1 do not activate rodent homologs . Researchers should:

      • Use humanized mouse models or human cell systems when testing receptor activity

      • Validate assay results across multiple experimental systems

    • Calcium Signaling Assays: Based on the role of MAS1L/MRGPRX1 in modulating calcium channels:

      • Measure high-voltage-activated calcium currents in appropriate neuronal populations

      • Consider using patch-clamp electrophysiology for detailed channel analysis

      • Implement calcium imaging for screening applications

    • G-Protein Coupling Assays: Assess G i/o pathway activation through:

      • GTPγS binding assays

      • cAMP inhibition assays

      • β-arrestin recruitment assays

    • Ligand Considerations: When testing receptor responses:

      • Include angiotensin metabolites as potential ligands

      • For related MRGPRX1, BAM8-22 serves as a useful agonist

      • Test positive allosteric modulators like ML382 in combination with agonists

    • Validation Controls: Include appropriate controls:

      • Cells lacking MAS1L expression

      • Cells expressing related receptors to assess specificity

      • Pharmacological inhibitors of downstream pathways

    These considerations will enhance the reliability and translational relevance of functional assays for MAS1L research.

  • How can researchers investigate potential interactions between MAS1L polymorphisms and environmental factors?

    Investigating gene-environment interactions for MAS1L requires multifaceted approaches:

    • Cohort Studies: Design studies that:

      • Collect detailed environmental exposure data

      • Genotype participants for MAS1L polymorphisms, particularly rs1233478

      • Apply statistical models that account for both genetic and environmental variables

    • Epigenetic Analyses: Examine:

      • DNA methylation patterns at the MAS1L locus

      • Histone modifications that might affect gene expression

      • Environmental factors that influence these epigenetic markers

    • Expression Quantitative Trait Loci (eQTL) Analysis:

      • Investigate how MAS1L polymorphisms affect gene expression

      • Examine if environmental factors modulate these expression effects

      • Use statistical frameworks like MIXALIME to identify allelic imbalance

    • Functional Validation:

      • Develop in vitro systems expressing different MAS1L variants

      • Expose these systems to relevant environmental factors

      • Measure functional outcomes (receptor signaling, calcium flux, etc.)

    • Animal Models:

      • Use humanized mice expressing MAS1L variants

      • Expose to controlled environmental conditions

      • Evaluate phenotypic outcomes relevant to diseases associated with MAS1L

    These approaches would provide insights into how MAS1L polymorphisms might interact with environmental factors to influence disease susceptibility, particularly in the context of autoimmune disorders like type 1A diabetes .

  • What are the challenges and solutions in producing recombinant MAS1L for structural studies?

    Producing recombinant MAS1L for structural studies presents several challenges that require specific methodological solutions:

    • Expression System Selection:

      • Mammalian Cells: HEK293T cells have been used successfully for MAS1L expression , providing proper folding and post-translational modifications

      • Insect Cells: Baculovirus expression systems offer higher yields while maintaining proper GPCR folding

      • Microbial Systems: Generally less suitable due to the complexity of GPCR folding

    • Protein Stabilization Strategies:

      • Introduce thermostabilizing mutations

      • Use fusion partners (T4 lysozyme, BRIL) to enhance stability

      • Apply conformational stabilization using nanobodies or antibody fragments

      • Incorporate detergent/lipid mixtures optimized for GPCR stability

    • Purification Challenges:

      • Use affinity tags (His, FLAG) for initial capture

      • Implement size exclusion chromatography to achieve homogeneity

      • Consider lipid nanodisc or bicelle incorporation for native-like environments

    • Validation Approaches:

      • Functional binding assays with known ligands (angiotensin metabolites)

      • Thermal stability assays to confirm proper folding

      • Negative stain electron microscopy to assess homogeneity

    • Structural Analysis Methods:

      • X-ray crystallography with lipidic cubic phase crystallization

      • Cryo-electron microscopy for structure determination without crystallization

      • NMR for dynamic studies of smaller receptor fragments

    By addressing these challenges methodically, researchers can produce high-quality recombinant MAS1L suitable for structural studies that would provide valuable insights into receptor function and ligand interactions.

  • How does allelic variation in MAS1L affect receptor function and disease risk?

    Allelic variation in MAS1L has significant implications for both receptor function and disease risk:

    • Disease Associations:

      • SNPs in the UBD/MAS1L region (particularly rs1233478) show strong association with type 1A diabetes (P = 1.6 × 10^-23, allelic odds ratio 2.0)

      • This association remains significant after adjustment for known HLA risk factors (P = 0.01)

    • Functional Impact Assessment Methodologies:

      • Allelic Imbalance Analysis: Tools like MIXALIME can identify allele-specific expression differences

      • Electrophysiological Studies: Patch-clamp recording to assess variant effects on calcium channel modulation

      • Signaling Pathway Analysis: Comparison of G-protein coupling efficiency between variants

      • Ligand Binding Studies: Evaluation of binding affinities for angiotensin metabolites

    • Functional Genomics Approaches:

      • CRISPR-Cas9 engineering to introduce specific variants

      • Isogenic cell lines differing only in MAS1L variants

      • Humanized mouse models expressing different human MAS1L variants

    • Clinical Implications:

      • Potential for pharmacogenomic stratification in pain management

      • Risk prediction for autoimmune disorders

      • Personalized therapeutic approaches based on genotype

    Understanding the functional consequences of MAS1L variants provides insights into disease mechanisms and identifies potential targets for therapeutic intervention, particularly in the context of pain management and autoimmune disorders.

  • What is known about the evolutionary conservation of MAS1L across species?

    The evolutionary conservation of MAS1L reveals important insights about receptor function and species-specific adaptations:

    • Species Differences:

      • Despite sharing 54% amino acid identity, human MRGPRX1 and mouse MRGPRC11 exhibit considerably different drug profiles

      • This divergence explains why many compounds targeting human receptors fail to activate rodent homologs

    • Functional Conservation:

      • Despite sequence divergence, the core function in modulating calcium channels appears conserved

      • Human MRGPRX1 inhibits HVA calcium currents through G i/o-sensitive pathways

      • Mouse MRGPRC inhibits similar channels but through phospholipase C-dependent mechanisms

    • Expression Pattern Conservation:

      • The restricted expression in nociceptive neurons is relatively conserved across species

      • This suggests evolutionary pressure to maintain tissue-specific functions

    • Ligand Responsiveness:

      • Response to angiotensin metabolites may represent an evolutionarily conserved property

      • Species-specific ligand preferences likely evolved to accommodate different physiological needs

    • Implications for Research:

      • Humanized mouse models are necessary to study human-specific receptor properties

      • Comparative studies across species can reveal essential vs. adaptable receptor features

      • Evolutionary analysis may guide the design of broad-spectrum or species-specific compounds

    This evolutionary perspective is crucial for interpreting experimental results across species and developing translational approaches for human applications.

  • How can computational approaches facilitate MAS1L-targeted drug discovery?

    Computational approaches offer powerful tools for accelerating MAS1L-targeted drug discovery:

    • Homology Modeling and Molecular Dynamics:

      • Generate structural models based on related GPCRs with known structures

      • Simulate receptor dynamics in membrane environments

      • Identify key binding sites and conformational changes

    • Virtual Screening Strategies:

      • Structure-based virtual screening against MAS1L models

      • Ligand-based approaches using known modulators (e.g., BAM8-22, ML382)

      • Machine learning models trained on existing GPCR ligand datasets

    • Allosteric Site Identification:

      • Computational mapping of potential allosteric binding pockets

      • Design of novel positive allosteric modulators (PAMs) similar to ML382

      • Prediction of allosteric communication networks within the receptor

    • Pharmacogenomic Analysis:

      • Modeling the impact of known polymorphisms (e.g., rs1233478) on receptor structure

      • Predicting variant-specific drug responses

      • Designing compounds with activity across relevant receptor variants

    • Network Pharmacology:

      • Mapping interaction networks for MAS1L in pain and immune pathways

      • Identifying multi-target strategies for enhanced efficacy

      • Predicting potential off-target interactions and side effects

    These computational approaches can significantly accelerate the identification and optimization of novel therapeutic agents targeting MAS1L, particularly for pain management applications where selective modulation of nociceptive pathways is desired.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.