Recombinant Human Melanin-concentrating hormone receptor 2 (MCHR2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Expression Systems:

  • Host Cell Line: CHO dhfr- (Chinese Hamster Ovary cells) .

  • Transfection: Full-length human MCHR2 cDNA (GenBank: NM_032503.1) under a constitutive promoter .

  • Stability: Maintains functionality for ≥2 months in culture with G418 selection .

Metabolic Implications:

  • IDH3A and PCK1 upregulation suggests enhanced mitochondrial energy production and gluconeogenesis .

  • INSIG2 downregulation may reduce lipid synthesis by modulating SREBP processing .

Physiological and Therapeutic Insights

Energy Homeostasis:

  • Transgenic mice co-expressing human MCHR2 and MCHR1 exhibit:

    • 18–22% lower body weight gain on high-fat diets .

    • Improved glucose tolerance and lipid profiles .

Neuromodulation:

  • MCHR2 activation opposes MCHR1-mediated inhibition of c-Fos, a neuronal activity marker .

  • Dual receptor expression alters feeding behavior, reducing caloric intake by 15–20% in HFD models .

Challenges and Future Directions

Species-Specific Limitations:

  • Absence of MCHR2 in rodents complicates in vivo studies, necessitating transgenic models or primate/dog studies .

Drug Development:

  • Selective MCHR2 agonists/antagonists could target metabolic disorders without cross-reacting with MCHR1 .

  • Current efforts focus on small-molecule screens using recombinant MCHR2-expressing cell lines .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
MCHR2; GPR145; SLT; Melanin-concentrating hormone receptor 2; MCH receptor 2; MCH-R2; MCHR-2; G-protein coupled receptor 145; GPRv17; MCH-2R; MCH2; MCH2R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
Uniprot No.

Target Background

Function
Melanin-concentrating hormone receptor 2 (MCHR2) is a G protein-coupled receptor that binds melanin-concentrating hormone (MCH). Upon activation, MCHR2 triggers the activation of phosphoinositide hydrolysis, leading to downstream signaling events.
Gene References Into Functions
  1. Evidence suggests the involvement of duplications in MCHR2 in the pathogenesis of alopecia areata in a Central European cohort. PMID: 27306922
  2. This study provides insights into the potential influence of MCHR2 and/or MCHR2-AS1 on obesity in psychiatric patients and the pathophysiology of atypical depression. PMID: 26461262
  3. Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2. PMID: 22123324
  4. Construction of the CHO cell line and research into the molecular characteristics of MCHR2 have established a strong foundation for further investigations into the function of the MCHR2 gene. PMID: 20099459
  5. MCH1 and MCHR2 receptors were investigated and found to differ from those in SVK14 cells. PMID: 12127971
  6. Molecular simulations of MCHR2 in free and hormone-bound forms provide insights into the amino acids responsible for transmitting structural changes from the agonist binding site to the G-protein coupling domains. PMID: 15229878
  7. MCHR2 is not a major contributor to polygenic obesity. PMID: 17698913
  8. MCHR2 positively mediates the regulation of melanin-concentrating hormone during preadipocyte differentiation and is involved in energy balance regulation without affecting preadipocyte proliferation. PMID: 19683862
  9. The 10-amino-acid cyclic core of the hMCH neuropeptide with the Arg attached to the N-terminus of the disulfide ring is sufficient for full activation of melanin-concentrating hormone receptor 2. PMID: 11478907

Show More

Hide All

Database Links

HGNC: 20867

OMIM: 606111

KEGG: hsa:84539

STRING: 9606.ENSP00000281806

UniGene: Hs.591342

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in the brain, with highest levels in cerebral cortex, hippocampus and amygdala. No expression detected in the cerebellum, thalamus or hypothalamus.

Q&A

What is MCHR2 and how does it functionally differ from MCHR1?

Melanin-concentrating hormone receptor 2 (MCHR2), also known as G-protein coupled receptor 145 (GPR145), is a seven-transmembrane G protein-coupled receptor encoded by the MCHR2 gene in humans . While both MCHR1 and MCHR2 bind melanin-concentrating hormone (MCH) and share some functional overlap, they exhibit distinct differences in their expression patterns, signaling pathways, and evolutionary conservation. Both receptors primarily function to regulate skin color, but additionally play roles in regulating food intake, energy expenditure, behavior, and emotional responses .

The key methodological consideration when studying MCHR2 versus MCHR1 is their differential expression across species. Unlike MCHR1, which is widely conserved, MCHR2 is only found in humans, dogs, ferrets, and some other primates and carnivores, but notably absent in common laboratory rodents including mice and rats . This species-specific expression pattern has significantly delayed research into MCHR2 as a therapeutic target, as early pharmaceutical research typically relies on rodent models.

What cellular models are available for studying human MCHR2?

Several recombinant cell systems have been developed to enable the study of human MCHR2 in controlled laboratory settings:

  • CHO dhfr- cells expressing full-length human MCHR2/GPR145 (GenBank Accession Number NM_032503.1)

  • U2OS cells (human osteosarcoma cell line) for MCHR-related redistribution assays

For functional characterization of MCHR2, stable cell lines expressing the receptor can be maintained in Alpha-MEM supplemented with 10% FBS and 400 μg/mL G418 . These cells remain stable in culture for a minimum of two months, making them suitable for extended experimental protocols.

When designing experiments with these cellular models, researchers should consider:

  • Calcium flux assays can be used to measure dose-dependent stimulation upon treatment with MCH or other ligands

  • Internalization of MCHR2-EGFP fusion proteins can be monitored to assess receptor trafficking and activation

  • High-content imaging approaches allow for visualization of receptor redistribution following agonist treatment

What gene expression changes occur following MCHR2 activation?

Treatment of human cells expressing MCHR2 with MCH results in specific gene expression changes that provide insight into the receptor's downstream signaling pathways. Notably, MCHR2 activation leads to:

  • Upregulation of IDH3A, PCK1, and PFKFB4

  • Downregulation of INSIG2 and ACOT8

These gene expression changes suggest involvement in metabolic pathways, consistent with the receptor's role in energy homeostasis. When designing experiments to measure such changes, researchers should consider time-dependent effects, dose-response relationships, and cell-type specific variations in expression patterns.

Transcriptome analysis represents a powerful approach for comprehensively identifying gene expression changes following MCHR2 activation. For instance, when studying potential therapeutic compounds targeting MCHR2, researchers have employed transcriptome analysis on multiple cell lines (A375, A549, MCF7, and PC3) following compound administration (typically 10 μM for 6 hours) . This approach has proven valuable for identifying novel indications for MCHR2-targeting molecules.

How can researchers overcome limitations in studying MCHR2 due to its absence in common rodent models?

The absence of MCHR2 in mice and rats presents a significant challenge for researchers, as these species are the predominant models for early pharmaceutical research . Several methodological approaches can help overcome this limitation:

  • Humanized mouse models: Generating transgenic mice expressing human MCHR2 under tissue-specific promoters

  • Alternative animal models: Utilizing species that naturally express MCHR2, such as dogs or ferrets, though these come with ethical and practical constraints

  • In vitro cellular models: Employing recombinant cell systems expressing human MCHR2, such as the CHO dhfr- cells with full-length human MCHR2/GPR145 (NM_032503.1)

  • Ex vivo tissue culture: Working with human tissue samples that express MCHR2 naturally

  • Computational approaches: Leveraging machine learning-based prediction models to identify MCHR2 antagonists, as demonstrated in the identification of compounds like KRX-104130

The optimal experimental design typically involves a combination of these approaches. Initial screening may be performed using in vitro cellular models and computational approaches, followed by validation in more complex systems such as organoids or alternative animal models that express MCHR2.

What challenges exist in developing MCHR2 antagonists and how can they be addressed?

Developing specific antagonists for MCHR2 presents several challenges, particularly regarding cardiotoxicity. A significant issue in developing MCHR receptor antagonists is that their binding sites share structural similarities with the human Ether-à-go-go-Related Gene (hERG) channel . Inhibition of hERG can cause cardiotoxicity, which has led to the failure of multiple MCHR antagonist candidates during clinical development.

A methodological approach to overcome this challenge involves:

  • Virtual screening using machine learning models: Implementing dual prediction models that simultaneously assess MCHR2 binding affinity and potential hERG-induced cardiotoxicity

  • Structure-activity relationship (SAR) studies: Developing compounds with structural modifications that retain MCHR2 affinity while reducing hERG binding

  • Transcriptome-based drug repositioning: Exploring additional therapeutic indications for successful MCHR2 antagonists to improve their risk-benefit profile

One successful example of this approach is the identification of KRX-104130, which demonstrates potent MCHR2 antagonistic activity without cardiotoxicity . This compound was discovered through virtual screening using MCHR2 binding affinity prediction models coupled with hERG-induced cardiotoxicity prediction models.

What methodological approaches are available for measuring MCHR2 activation and signaling?

Several experimental approaches can be employed to study MCHR2 activation and downstream signaling:

Calcium Flux Assays:

  • Utilize Multiscreen Calcium 1.0 No Wash Assay Kit to measure dose-dependent stimulation of calcium flux upon ligand treatment

  • Allow for quantitative measurement of receptor activation in real-time

Receptor Redistribution Assays:

  • Monitor the internalization of membrane-localized MCHR2-EGFP fusion proteins using high-content imaging

  • Provide visual confirmation of receptor activation and trafficking

Transcriptome Analysis:

  • Measure changes in gene expression following MCHR2 activation using RNA-seq or microarray approaches

  • Identify downstream pathways and potential new therapeutic indications

Protein Expression Analysis:

  • Quantify changes in protein levels (such as LDLR) in response to MCHR2 modulation using Western blotting or ELISA

  • Confirm that transcriptional changes translate to functional protein alterations

When designing experiments utilizing these methods, researchers should consider:

  • Appropriate positive and negative controls

  • Time-dependent responses (acute vs. chronic activation)

  • Dose-response relationships

  • Cell type-specific effects

  • Potential cross-talk with other signaling pathways

How can transcriptome analysis be utilized to identify novel functions of MCHR2?

Transcriptome analysis represents a powerful approach for uncovering new functions and therapeutic applications of MCHR2. This methodology has successfully identified unexpected roles for MCHR2-targeting compounds:

  • Experimental Design: Treat appropriate cell lines (such as A375, A549, MCF7, and PC3) with the compound of interest (typically 10 μM) for 6 hours in both control and treatment groups

  • Data Collection: Perform RNA sequencing in triplicate to account for experimental variability, using the average value for comparison

  • Data Analysis: Calculate fold change (FC) by dividing the gene expression value of the control group by that of the treatment group, expressing positive or negative values based on direction of change

  • Validation Studies: Confirm key findings with orthogonal methods such as qPCR or protein expression analysis

For example, transcriptome analysis of KRX-104130-treated HepG2 cells revealed upregulation of the LDLR gene in a concentration-dependent manner, which was subsequently validated at both mRNA and protein levels . This finding suggests potential applications for MCHR2 antagonists in cholesterol management, expanding their therapeutic potential beyond traditional applications related to energy homeostasis.

What control measures should be implemented in MCHR2 functional assays?

When designing experiments to study MCHR2 function, several control measures should be implemented to ensure robust and reproducible results:

  • Positive Controls: Include known MCHR2 agonists such as synthetic MCH peptide at established effective concentrations (typically 5 μM)

  • Negative Controls: Utilize vehicle controls (typically DMSO at equivalent concentrations) to account for non-specific effects

  • Concentration Series: Employ dose-response curves rather than single concentrations to establish EC50/IC50 values for compounds of interest

  • Time Course Studies: Assess both immediate and delayed responses to capture the full spectrum of MCHR2 signaling events

  • Cell Viability Assessments: Monitor potential cytotoxicity using secondary high-content outputs such as:

    • Nucleus size, shape, and intensity (indicators of DNA damage, cell cycle effects, and apoptosis)

    • Cell number, size, and shape (markers of acute cytotoxicity and apoptosis)

    • Cell fluorescence intensity (parameter for compound cytotoxicity and fluorescence)

  • Specificity Controls: Compare effects on MCHR2-expressing cells with parental cells lacking the receptor to confirm receptor-specific actions

These control measures help distinguish true MCHR2-mediated effects from experimental artifacts, enhancing the reliability and reproducibility of research findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.