Recombinant Human Melanocortin-2 receptor accessory protein 2 (MRAP2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Melanocortin-2 Receptor Accessory Protein 2 (MRAP2)

Recombinant Human Melanocortin-2 Receptor Accessory Protein 2 (MRAP2) is a protein that in humans is encoded by the MRAP2 gene . MRAP2, a homolog of MRAP, is expressed in the brain and adrenal gland . It is involved in regulating the function of melanocortin receptors (MCRs) . The melanocortin receptor (MCR) family consists of five G protein-coupled receptors (MC1R–MC5R) that have different physiological roles .

Structure and Function

MRAP2 is a single-pass transmembrane domain protein that localizes to the cell surface and undergoes post-translational modification, including N-terminal glycosylation . It has approximately 40% sequence homology to MRAP .

MRAP2, like MRAP, can support MC2R cell-surface expression, which produces a functional ACTH-responsive receptor . Furthermore, MRAP2 and MRAP modulate other MCRs . MRAP2 also moderates the signaling of certain G-protein coupled receptors (GPCRs), such as orexin, prokineticin, and GHSR1a (ghrelin receptor) .

Mechanism of Action

MRAP2 influences the expression, localization, signaling, and internalization of melanocortin receptors . Studies show MRAP and MRAP2 interact with all five MCRs, impacting their function . Specifically, this interaction results in MC2R surface expression and signaling . Additionally, MRAP2 enhances the MC3 and MC4 response to the agonist αMSH .

Clinical Significance

MRAP2 is involved in regulating appetite and energy homeostasis . Genetic variants in MRAP2 have been linked to monogenic hyperphagic obesity with hyperglycemia and hypertension .

Loss-of-function mutations in MRAP2 are associated with an increased risk of obesity in both adults and children . A study sequenced the MRAP2 gene in 9,418 participants and identified 23 rare heterozygous variants, 14 of which were novel. The study found a significant association between these rare MRAP2 variants and an increased risk of obesity in adults (OR = 3.80, 95% CI: 1.71–9.26) and in children or adolescents (OR = 2.91, 95% CI: 1.23–7.32) .

MRAP2 VariantsNumber of ParticipantsP ValueOdds Ratio95% Confidence Interval
Adults148.04 × 10^(-4)3.801.71–9.26
Children/Adolescents130.01482.911.23–7.32

MRAP2 and Melanocortin-3 Receptor (MC3R) Interaction

MRAP2 directly interacts with MC3R and affects its signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MRAP2; C6orf117; Melanocortin-2 receptor accessory protein 2; MC2R accessory protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MRAP2
Target Protein Sequence
MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFM FFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYI NEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGED DLLISEPPIVLETKPLSQTSHKDLD
Uniprot No.

Target Background

Function

Recombinant Human Melanocortin-2 receptor accessory protein 2 (MRAP2) is a modulator of the melanocortin receptor 4 (MC4R), a key receptor in energy homeostasis. MRAP2 plays a critical role in regulating energy balance and body weight by enhancing MC4R ligand sensitivity and cAMP generation. It may also act as a negative regulator of MC2R, competing with MRAP for MC2R binding and inhibiting corticotropin (ACTH) binding. While potential regulatory effects on other melanocortin receptors (MC1R, MC3R, and MC5R) are suggested, further in vivo research is needed.

Gene References Into Functions
  1. Recent research challenges the established understanding of Melanocortin Receptor Accessory Proteins (MRAPs) as specific melanocortin receptor regulators, highlighting MRAP2's inhibitory effect on prokineticin receptors. Studies are elucidating MRAP's unique structure and MRAP2's importance in maintaining energy and glucose homeostasis. PMID: 28499989
  2. This study reveals a novel role for MRAP2 in regulating the orexin receptor 1 (OX1R) and identifies the crucial MRAP2 regions involved in OX1R and PKR1 regulation. Similar to MC4R and PKRs, OX1R's predominant expression in the brain influences food intake. PMID: 28939058
  3. This study was the first to describe the impact of a MRAP2 mutation on human melanocortin-4 receptor function. PMID: 27474872
  4. No gene deletions were found in the SIM1 and MRAP2 regions within the Prader-Willi-like (PWL) cohort. Further functional analysis of p.P352S (SIM1) and p.A40S (MRAP2) could clarify their potential roles in the pathogenesis of the PWL phenotype. PMID: 26795956
  5. MC3R, a two-exon gene, requires a 5' UTR for translation, localization, and potential interaction with MRAP2. PMID: 25051171
  6. A study on individuals with severe, early-onset obesity identified four rare, potentially pathogenic MRAP2 variants, suggesting its contribution to human body weight regulation. PMID: 23869016
  7. MRAP2 regulates the expression of melanocortin receptors (MC1R-MC5R). Its high expression in fetal adrenal glands and hypothalamus (a site with high MC3R and MC4R levels) is notable. PMID: 23418361
  8. ACTH and AngII positively regulate MRAP2 in human adrenocortical tissues. PMID: 22419722
  9. The MC2R/MRAP2 complex requires significantly higher ACTH concentrations for activation compared to the MC2R/MRAP complex. PMID: 21367968
  10. MRAP2 acts as an endogenous inhibitor, competing with MRAP for MC2R binding and reducing adrenocorticotropic hormone (ACTH) potency. PMID: 20371771
Database Links

HGNC: 21232

OMIM: 601665

KEGG: hsa:112609

STRING: 9606.ENSP00000257776

UniGene: Hs.370055

Involvement In Disease
Obesity (OBESITY)
Protein Families
MRAP family
Subcellular Location
Cell membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the adrenal gland and brain. Not expressed in other tissues.

Q&A

What is MRAP2 and how does it relate to MRAP1?

MRAP2 is a homologue of MRAP1 (originally identified as essential for ACTH receptor/melanocortin 2 receptor function). Both are single-pass transmembrane domain proteins that can form antiparallel homodimers. While MRAP1 is essential for MC2R trafficking and function, MRAP2 has broader regulatory effects across multiple receptors. MRAP2, like MRAP1, is glycosylated at the N-terminus, and this post-translational modification appears to be functionally important .

To study the relationship between MRAP1 and MRAP2:

  • Compare tissue expression patterns using RT-PCR across multiple tissues

  • Analyze protein sequence homology using alignment tools

  • Conduct comparative co-immunoprecipitation studies with various receptors

  • Perform mutagenesis studies targeting conserved domains

What is the tissue distribution pattern of MRAP2?

MRAP2 has a distinct tissue expression pattern from MRAP1, with principal expression in the brain and adrenal gland . Research shows MRAP2 is also expressed in human metabolic tissues including pancreatic islets, gut, kidney, adipose tissue, and skeletal muscle .

For accurate tissue distribution analysis:

  • Use quantitative RT-PCR with intron-spanning primers to avoid genomic DNA amplification

  • Validate expression using Western blot with specific antibodies

  • Employ immunohistochemistry to identify specific cell types expressing MRAP2

  • Consider single-cell RNA sequencing for detailed cellular distribution

What is the structural topology of MRAP2?

MRAP2 adopts a unique dual-topology homodimeric structure that is resistant to SDS, reducing agents, and heat. Western blotting reveals an approximately 48-kDa band in adrenal gland and brain tissue, consistent with an MRAP2 dimeric structure in vivo . This antiparallel orientation appears critical for function .

Methodological approaches to study MRAP2 topology:

  • Use epitope tagging at both N- and C-termini (e.g., FLAG, MYC tags)

  • Apply live-cell immunofluorescence staining to determine membrane orientation

  • Employ crosslinking studies with dithiobis (succinimidyl propionate)

  • Use glycosylation site mapping to confirm N-terminal orientation

How does MRAP2 interact with melanocortin receptors?

MRAP2 interacts with all five melanocortin receptors (MC1R-MC5R) as demonstrated by co-immunoprecipitation studies . For MC2R, MRAP2 facilitates trafficking to the cell surface but requires significantly higher ACTH concentrations for signaling compared to MRAP1 . For MC1R, MC3R, MC4R, and MC5R, MRAP2 can reduce receptor responsiveness to [Nle4,D-Phe7]alpha-melanocyte-stimulating hormone (NDP-MSH) .

To study these interactions:

  • Perform co-immunoprecipitation with HA-tagged MCRs and FLAG- or MYC-tagged MRAP2

  • Use cell-surface expression assays to quantify receptor trafficking

  • Measure cAMP generation to assess functional effects

  • Employ BRET/FRET assays to measure direct protein-protein interactions

What is the molecular mechanism by which MRAP2 regulates MC4R function?

MRAP2 is critical for the weight-regulating function of MC4R neurons and the ciliary localization of MC4R. Targeting of MC4R to neuronal primary cilia is essential for the control of long-term energy homeostasis . Recent modeling suggests MRAP2 may interact with melanocortin receptors at TM5-TM6 regions, which are important for receptor activation and G protein coupling .

Experimental approaches:

  • Use immunofluorescence microscopy to track ciliary localization of MC4R

  • Compare wild-type and mutant MC4R trafficking in the presence/absence of MRAP2

  • Employ cell-specific knockout models (e.g., MC4R neuron-specific MRAP2 deletion)

  • Utilize ligand binding assays to assess receptor affinity changes

What experimental systems are optimal for studying MRAP2-receptor interactions?

Different experimental systems have yielded contradictory results regarding MRAP2 function. For example, some studies showed MRAP2 enables MC2R response to ACTH while others found the receptor unresponsive . This variability highlights the importance of selecting appropriate experimental systems.

Recommended approaches:

  • Compare multiple cell lines (HEK293, CHO, Y1 adrenal cells)

  • Use neuronal cell lines for MC4R studies due to its CNS expression

  • Consider primary neuronal cultures for physiologically relevant conditions

  • Employ tissue-specific expression systems rather than only heterologous expression

  • Validate findings across multiple experimental platforms

How can researchers accurately measure MRAP2's effects on receptor trafficking versus signaling?

MRAP2 has distinct effects on receptor trafficking and signaling that must be separately evaluated. For instance, N9Q-FLAG mutant MRAP2 assists MC2R trafficking to the cell surface but fails to enable receptor signaling .

Methodological separation:

  • Use cell-surface labeling techniques (biotinylation, fluorescent antibodies)

  • Implement confocal microscopy with fluorescently tagged receptors

  • Measure receptor signaling via multiple pathways (G protein activation, cAMP production)

  • Employ bioluminescence resonance energy transfer (BRET) to monitor receptor-effector coupling

How can researchers effectively analyze the impact of MRAP2 mutations on receptor function?

To investigate MRAP2 structure-function relationships, researchers have created variant conformations by inverting or transposing domains. These variants showed proper formation of antiparallel homodimers and binding to MC4R but altered regulatory effects on receptor function .

Recommended mutation analysis approach:

  • Construct systematic mutations targeting key domains (N-terminal, transmembrane, C-terminal)

  • Characterize both structural impacts (dimerization, receptor binding) and functional effects

  • Employ dose-response curves to assess changes in potency and efficacy

  • Compare effects across multiple receptor types

What approaches best model MRAP2's role in energy homeostasis?

MRAP2 plays a crucial role in energy homeostasis, with different phenotypes observed between global and MC4R neuron-specific Mrap2 deletion in mice. Global deletion causes late-onset hyperphagia and obesity, while MC4R neuron-specific deletion leads to early-onset hyperphagia and obesity .

Recommended experimental models:

  • Compare tissue-specific knockout models (global vs. neuron-specific)

  • Utilize CRISPR/Cas9 technology for precise genetic manipulation

  • Implement metabolic phenotyping (food intake, energy expenditure, glucose tolerance)

  • Measure hormone levels associated with metabolism (leptin, ghrelin, insulin)

How do loss-of-function mutations in MRAP2 contribute to human obesity?

Loss-of-function mutations in MRAP2 are associated with hyperphagic obesity in humans, with a phenotype that includes hyperglycemia and hypertension. This differs from MC4R deficiency, suggesting MRAP2 has broader roles beyond MC4R regulation .

Research methodology:

  • Perform genetic screening in obesity cohorts

  • Characterize functional impacts of identified mutations

  • Compare phenotypic data between MRAP2 and MC4R mutation carriers

  • Implement genotype-phenotype correlation studies

How does MRAP2 interact with non-melanocortin receptors?

MRAP2 interacts with receptors beyond the melanocortin family, including prokineticin receptors and the growth hormone secretagogue receptor 1a (GHSR1a), the ghrelin receptor . This may explain the broader metabolic phenotypes observed in MRAP2-deficient models.

Experimental approaches:

  • Use BRET assays to measure direct interaction with various GPCRs

  • Implement cross-linking studies to verify physical association

  • Assess functional impacts through signaling assays (G protein activation, β-arrestin recruitment)

  • Perform domain mapping to identify interaction interfaces

What methodologies best characterize MRAP2's regulation of β-arrestin recruitment?

MRAP2 inhibits β-arrestin-2 recruitment to Prokineticin Receptor 2 (PKR2). This effect appears dependent on the C-terminal region of PKR2, as demonstrated by experiments with PKR2-ΔC52 mutant receptors .

Recommended experimental design:

  • Implement BRET assays with luminescent receptors and GFP-tagged β-arrestin-2

  • Perform concentration-response curves with various receptor:MRAP2 ratios

  • Compare wild-type receptors with C-terminal truncation mutants

  • Measure downstream signaling consequences (ERK phosphorylation, receptor internalization)

For optimal results, researchers should conduct concentration-dependent experiments, as shown in Figure 2 of reference , where increasing MRAP2:receptor ratios (1:5, 1:15) demonstrated progressive inhibition of β-arrestin-2 recruitment.

How can contradictory findings regarding MRAP2's role in MC2R signaling be reconciled?

Studies have reported contradictory findings about MRAP2's ability to enable MC2R response to ACTH. Some showed functionality while others reported unresponsiveness . The resolution appears to be dose-dependent, with MRAP2-associated MC2R requiring 1000-fold higher ACTH concentrations compared to MRAP1-associated MC2R.

Research strategy to resolve contradictions:

  • Implement wide-range dose-response curves (10^-12 to 10^-6 M ACTH)

  • Standardize expression systems and quantify receptor:accessory protein ratios

  • Consider physiological ACTH concentrations in experimental design

  • Test combinatorial effects of MRAP1 and MRAP2 co-expression

What are the emerging techniques for studying MRAP2 structure and function?

Recent advances include AI-based structural modeling of MRAP2-receptor complexes, suggesting that MRAP2 may interact with TM5-TM6 regions of melanocortin receptors . These regions are known to be critical for receptor activation and G protein coupling.

Cutting-edge methodological approaches:

  • Implement cryo-electron microscopy to resolve MRAP2-receptor complexes

  • Use molecular dynamics simulations to model interaction dynamics

  • Apply AlphaFold or similar AI tools for structure prediction

  • Develop nanobody-based probes for conformational studies

By employing these advanced approaches, researchers can continue to unravel the complex roles of MRAP2 in receptor regulation and energy homeostasis, potentially leading to novel therapeutic targets for metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.