Recombinant Human Melatonin-related receptor (GPR50)

Shipped with Ice Packs
In Stock

Description

Functional Properties

GPR50 exhibits ligand-independent regulatory roles:

  • MT1 Antagonism: Forms heterodimers with MT1, abolishing melatonin binding and G-protein coupling .

  • Metabolic Regulation: Knockout mice show altered energy metabolism and reduced fat stores .

  • Neuronal Development: Acts as a mitophagy receptor, maintaining mitochondrial OXPHOS in neurons .

  • TGFβ Signaling: Promotes constitutive TGFβ receptor I (TβRI) activity, enhancing Smad2/3 phosphorylation .

Key Studies

  1. Heterodimerization with MT1/MT2

    • GPR50 inhibits MT1 function by blocking agonist binding and G-protein activation, while MT2 remains unaffected .

    • Deletion of GPR50’s C-terminal tail restores MT1 activity, implicating this domain in regulatory interactions .

  2. Thermogenesis and Metabolism

    • GPR50-knockout mice exhibit elevated metabolic rates and reduced adiposity, linking it to adaptive thermogenesis .

  3. Neurological and Psychiatric Associations

    • Δ502-505 and T532A variants correlate with bipolar disorder, depression, and autism spectrum disorders .

    • Endogenous GPR50/MT1 complexes in endothelial cells regulate cerebral blood flow via melatonin signaling .

  4. Cancer and Signaling Pathways

    • GPR50 interacts with TβRI to drive Smad2/3 activation independently of TGFβ, implicating it in cancer progression .

Applications in Research

Recombinant GPR50 is utilized for:

  • Functional Assays: Studying GPCR dimerization and signaling crosstalk .

  • Drug Discovery: Targeting metabolic or neurological disorders via orphan receptor modulation .

  • Structural Studies: AlphaFold models enable virtual screening for potential ligands .

Preparation and Availability

Recombinant GPR50 is produced via:

  • HEK293 Systems: For full-length or truncated constructs .

  • Antibody Development: Custom services for anti-GPR50 antibodies (Creative Biolabs ).

  • Commercial Sources: Available from suppliers like R&D Systems (Catalog #: C1110) .

Expression SystemFeatures
HEK293High-yield membrane protein production
Insect CellsPost-translational modifications

Future Directions

  • Ligand Identification: High-throughput screening to deorphanize GPR50 .

  • Therapeutic Targeting: Exploiting its role in metabolic diseases or cancer .

  • Neurological Studies: Clarifying mitophagy mechanisms in neurodevelopment .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time information, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize fulfilling your specified tag request.
Synonyms
GPR50; Melatonin-related receptor; G protein-coupled receptor 50; H9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-617
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY HDVVVIDVEDDPDEMAV
Uniprot No.

Target Background

Function
This protein does not bind to melatonin.
Gene References Into Functions
  1. GPR50 functions as a TbetaRI co-receptor, potentially influencing cancer development. PMID: 29572483
  2. In pre-eclampsia (PE), plasma IgG1 anti-Epstein-Barr virus nuclear antigen 1 (EBNA-1) antibody cross-reacts with placental protein G protein-coupled receptor 50 (GPR50). PMID: 27181993
  3. Research findings provide deeper insight into the functional evolution of GPR50 in mammals at the molecular level. PMID: 25730005
  4. A weak female-specific association was observed between GPR50 variants and late-life depression. No significant associations were found in men. PMID: 25798330
  5. A study revealed an association between Seasonal Affective Disorder (SAD) and a single nucleotide polymorphism (intronic rs2072621) of the gene encoding GPR50 in females. PMID: 21565467
  6. Positive expression of melatonin receptor is observed in both human hypertrophic scar and normal skin, but it is higher in scar tissue. PMID: 20737950
  7. Two polymorphisms were identified in the GPR50 receptor of patients with adolescent idiopathic scoliosis, but their frequency was not significantly different from controls. PMID: 20733416
  8. Antibodies were employed to investigate GPR50 expression in the mouse, rat, and human hypothalamus. GPR50 immunoreactivity (ir) was observed in dorsomedial hypothalamic (DMH) cells and in cells of the ependymal layer of the third ventricle of the hypothalamus. PMID: 20210849
  9. This is the first association of rs1202874 with BD and is the second positive association observed at the GPR50 locus. PMID: 20371266
  10. Research identified neurite outgrowth inhibitor NOGO-A as an interacting partner of GPR50. Both Gpr50 and neuronal Nogo-A were found enriched at the synapse. PMID: 19699797
  11. Polymorphisms in GPR50 were compared in bipolar affective disorder (BD), major depressive disorder (MDD), schizophrenia (SCZ), and controls. GPR50(Delta502-505) or a variant appears to be a sex-specific risk factor for susceptibility to BD and SCZ. PMID: 15452587
  12. Research findings describe sequence variants in the melatonin-related receptor gene (GPR50) that associate with circulating triglyceride and HDL levels. PMID: 16436372
  13. GPR50, an orphan GPCR, forms constitutive and specific heterodimers with MT(1) and MT(2) melatonin receptors. PMID: 16778767
  14. No evidence supporting an association between this gene and mood disorders was found in a Hungarian population. PMID: 18075476

Show More

Hide All

Database Links

HGNC: 4506

OMIM: 300207

KEGG: hsa:9248

STRING: 9606.ENSP00000218316

UniGene: Hs.567390

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Hypothalamus and pituitary.

Q&A

What is the molecular structure and basic function of GPR50?

GPR50 is an X-chromosome-linked orphan G protein-coupled receptor that shares highest sequence homology with melatonin receptors MT1 and MT2 among all GPCRs . Unlike MT1 and MT2, GPR50 does not bind melatonin or any other identified ligand, maintaining its orphan receptor status .

The receptor contains a large C-terminal tail that plays a critical regulatory role in protein-protein interactions . Recent research has identified GPR50 as having a LC3-interacting region (LIR), enabling it to function as a mitophagy receptor . GPR50 is primarily expressed in the hypothalamus, pituitary gland, and brain regions with blue plaques , with neurons being the predominant cell type expressing this receptor .

Methodologically, researchers should:

  • Use specific antibodies validated against GPR50-knockout controls when studying expression patterns

  • Consider the X-linked nature of the gene when designing experiments and analyzing sex differences

  • Be aware that GPR50 functions may differ significantly from other melatonin receptor family members despite sequence homology

How does GPR50 interact with melatonin receptors, and what are the functional consequences?

GPR50 forms constitutive homodimers and heterodimers with MT1 and MT2 melatonin receptors in intact cells, as demonstrated through biochemical and biophysical approaches . The heterodimeric interactions have significant functional consequences, particularly for MT1:

  • GPR50/MT1 heterodimers: GPR50 abolishes high-affinity agonist binding and G protein coupling to the MT1 protomer within the heterodimer

  • GPR50/MT2 heterodimers: Association does not significantly modify MT2 function

The inhibitory effect of GPR50 on MT1 receptor function depends on GPR50's C-terminal tail. Deletion of this domain suppresses the inhibitory effect without affecting the heterodimerization itself, indicating this region regulates the interaction of regulatory proteins with MT1 .

Research methodology should include:

  • BRET (Bioluminescence Resonance Energy Transfer) assays to detect receptor dimerization in intact cells

  • Radioligand binding studies using 125I-MLT to assess melatonin binding capacity

  • Functional G protein coupling assays using G protein chimeras such as Gαi/q

What experimental approaches are recommended for studying GPR50 expression?

When investigating GPR50 expression, researchers should employ multiple complementary techniques:

  • Immunofluorescence staining: Validated antibodies against GPR50 can be used for tissue sections and cultured cells. Important controls include GPR50-knockout tissues/cells to confirm antibody specificity .

  • In situ hybridization: For mRNA localization in tissues when protein detection is challenging.

  • Western blotting: To quantify protein expression levels in different tissues or experimental conditions.

  • RT-qPCR: For quantitative assessment of GPR50 mRNA expression across tissues or in response to experimental manipulations.

  • Sex-stratified analysis: Given that GPR50 is located on the X chromosome, expression analysis should always be stratified by sex, as significant differences in GPR50 methylation and expression have been observed between males and females .

What is GPR50's role in mitophagy, and how can researchers investigate this function?

GPR50 has been identified as a novel mitophagy receptor that harbors an LC3-interacting region (LIR) and is required for mitophagy under stress conditions . The protein is recruited to depolarized mitochondrial membranes during mitophagy stress, where it:

  • Marks mitochondrial portions for degradation

  • Recruits assembling autophagosomes

  • Facilitates engulfment of mitochondrial fragments by autophagosomes

Disease-related mutations Δ502-505 and T532A attenuate GPR50-mediated mitophagy by disrupting:

  • The binding of GPR50 to LC3

  • The mitochondrial recruitment of GPR50

Methodological approaches to study GPR50's role in mitophagy include:

  • TMRE fluorescence assays: To assess mitochondrial membrane potential in GPR50-deficient versus wild-type cells

  • Transmission electron microscopy (TEM): To visualize mitochondrial morphology changes and detect abnormalities such as cristae swelling and vacuolization

  • High-resolution respirometry: To measure oxygen consumption rate (OCR) through mitochondrial complexes I, II, and IV, as well as maximum electron transport system capacity and spare respiratory capability

  • ATP production assays and ROS detection: To assess functional consequences of GPR50 deficiency on mitochondrial metabolism

  • Rescue experiments: Using wild-type GPR50 versus mutant constructs (mLIR or ASD-associated mutations) to validate specificity of observed phenotypes

How is GPR50 involved in neuropsychiatric disorders, and what experimental models are available?

GPR50 has been genetically associated with several neuropsychiatric conditions:

  • Autism Spectrum Disorder (ASD): Mutations Δ502-505 and T532A have been detected in patients with ASD

  • Bipolar disorder and major depression: A deletion mutant of GPR50 has been associated with these conditions, particularly in Scottish females

  • Alzheimer's Disease (AD): Hypomethylation of the GPR50 promoter in peripheral blood has been identified as a potential biomarker for AD diagnosis in Chinese Han males

  • Metabolic disorders: Some GPR50 variants are associated with higher triglyceride levels and lower HDL-cholesterol levels

Experimental models and methods for investigating GPR50 in these disorders include:

  • GPR50-deficient mice: These animals exhibit impaired social recognition, which can be rescued by prenatal treatment with mitoQ, a mitochondrial antioxidant

  • Cell culture models: Using GPR50-knockdown or knockout cell lines to study effects on neural progenitor cell proliferation, differentiation, and neurite outgrowth

  • Methylation analysis: Bisulfite pyrophosphate sequencing to determine methylation levels of the GPR50 promoter in patient samples compared to controls

  • Correlation with clinical parameters: Statistical analysis to identify associations between GPR50 methylation levels and clinical biomarkers, such as the positive correlation observed between GPR50 methylation and plasma cholinesterase levels in female AD patients (r=0.489, P=0.039)

What are the sex-specific differences in GPR50 expression and function, and how should they influence experimental design?

GPR50 exhibits significant sex-specific differences in expression and methylation, likely due to its location on the X chromosome . Key observations include:

  • Methylation differences:

    • Female AD patients show significantly higher GPR50 methylation levels compared to male AD patients (33.00% vs. 9.15%, P<0.0001)

    • Healthy female controls also show higher GPR50 methylation than male controls (29.41% vs. 16.67%, P<0.0001)

  • Disease associations:

    • GPR50 hypomethylation is significantly associated with AD in males (9.15% vs. 16.67%, P=0.002)

    • In Scottish females, GPR50 has been identified as a risk gene for major depression and bipolar disorder

These sex differences have important implications for experimental design:

  • Sex stratification: All studies involving GPR50 should analyze data separately for males and females

  • Sample size considerations: Studies should ensure adequate power for sex-stratified analyses

  • Hormonal influences: Consider controlling for or investigating potential interactions with sex hormones

  • X-chromosome inactivation: In females, random X-chromosome inactivation means that approximately half of cells express the maternal X chromosome while the other half express the paternal X chromosome, potentially creating cellular mosaicism that should be considered in experimental design and analysis

How can researchers experimentally assess the impact of GPR50 on mitochondrial function and oxidative phosphorylation?

GPR50 deficiency impairs mitochondrial OXPHOS, resulting in insufficient ATP production and excessive ROS generation . Researchers can assess these effects using the following methodological approaches:

  • High-resolution respirometry:

    • Measure oxygen consumption rate (OCR) through complexes I, II, and IV

    • Assess maximum electron transport system (ETS) capacity

    • Determine spare respiratory capability

    • Measure proton leak, which is closely associated with ATP and ROS production

  • ATP production assays:

    • Quantify cellular ATP levels in GPR50-deficient versus wild-type cells

    • Perform rescue experiments with wild-type and mutant GPR50 constructs

  • ROS detection:

    • Measure reactive oxygen species levels using fluorescent probes

    • Perform mitochondria-specific ROS detection

    • Test ROS scavengers like mitoQ to confirm mitochondrial origin of ROS

  • Mitochondrial membrane potential assessment:

    • Use TMRE fluorescence to evaluate mitochondrial membrane potential

    • Compare fluorescent density between GPR50-deficient and wild-type cells

  • Transmission electron microscopy:

    • Visualize mitochondrial ultrastructure

    • Assess cristae morphology, vacuolization, and swelling

  • Mitochondrial protein quantification:

    • Measure levels of mitochondrial proteins such as TOMM20 to assess mitochondrial accumulation

What strategies can be employed to investigate potential therapeutic targets related to GPR50 function?

Based on GPR50's roles in mitophagy, neuronal development, and association with various neuropsychiatric disorders, several therapeutic targeting strategies can be explored:

  • Mitochondrial antioxidants:

    • MitoQ has been shown to rescue social recognition deficits in GPR50-deficient mice when administered prenatally

    • Researchers can test other mitochondrial-targeted antioxidants in GPR50-deficient models

  • Enhancing mitophagy:

    • Compounds that enhance mitophagy might compensate for GPR50 deficiency

    • Screen for molecules that can bypass the need for GPR50 in mitophagy pathways

  • GPR50-MT1 heterodimer modulation:

    • Develop compounds that can disrupt or enhance GPR50-MT1 heterodimer formation

    • Test whether modulating this interaction affects melatonin signaling in relevant tissues

  • Epigenetic approaches:

    • Given the association between GPR50
      methylation and Alzheimer's disease , investigate epigenetic modulators that might normalize GPR50 expression

  • Structure-based drug design:

    • Determine the 3D structure of GPR50, especially the LIR domain and regions affected by disease-associated mutations

    • Design peptides or small molecules that mimic functional domains of GPR50

Experimental approaches should include:

  • In vitro screening assays using GPR50-deficient and wild-type cells

  • Validation in animal models of GPR50 deficiency

  • Sex-stratified analyses to account for X-chromosome location

  • Combination with clinically relevant outcome measures for neuropsychiatric disorders

What expression systems are optimal for producing functional recombinant human GPR50?

For researchers working with recombinant GPR50, several expression systems can be considered, each with specific advantages:

  • Mammalian cell systems (HEK293T cells):

    • Most physiologically relevant for studying GPR50 function

    • Enables proper post-translational modifications

    • Suitable for studying receptor dimerization and interactions with other proteins

    • Recommended for functional studies involving signaling pathways

  • Insect cell systems (Sf9, Hi5):

    • Higher protein yields than mammalian cells

    • Maintains most post-translational modifications

    • Useful for structural studies requiring larger protein quantities

  • Bacterial systems (E. coli):

    • Highest yield but lacks post-translational modifications

    • Suitable for producing truncated versions (particularly the C-terminal tail) for binding studies

    • Not recommended for full-length functional GPR50 due to improper folding of transmembrane domains

Methodological considerations:

  • Include epitope tags (e.g., YFP, Rluc) for detection and quantification

  • Validate expression using Western blotting and fluorescence microscopy

  • Confirm functionality through dimerization assays (BRET) or mitophagy assays

How can mutations in GPR50 be evaluated for their impact on receptor function?

To assess the functional consequences of GPR50 mutations, particularly disease-associated variants like Δ502-505 and T532A, researchers can employ these methodological approaches:

  • Protein-protein interaction assays:

    • BRET assays to measure interactions with MT1, MT2, or LC3

    • Co-immunoprecipitation to validate protein interactions

    • Yeast two-hybrid screening to identify novel interacting partners affected by mutations

  • Cellular localization studies:

    • Fluorescence microscopy to assess subcellular localization

    • Co-localization analysis with mitochondria under basal and stress conditions

  • Mitophagy assays:

    • TMRE staining to evaluate mitochondrial membrane potential

    • Mitochondrial degradation assays following mitophagy induction

    • LC3 puncta formation and co-localization with mitochondria

  • Functional rescue experiments:

    • Transfection of mutant vs. wild-type GPR50 into GPR50-deficient cells

    • Assessment of key phenotypes: mitochondrial function, ATP production, ROS levels

  • Structural analysis:

    • In silico modeling of mutation effects on protein structure

    • Circular dichroism to assess changes in protein secondary structure

    • Limited proteolysis to evaluate conformational changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.