Recombinant Human Membralin (C19orf6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TMEM259; C19orf6; Membralin; Transmembrane protein 259
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM259
Target Protein Sequence
MSEHVEPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSRLF PPAFRRLFEFFVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDKWPREGILRVEVRHNSS RAPVFLQFCDSGGRGSFPGLAVEPGSNLDMEDEEEEELTMEMFGNSSIKFELDIEPKVFK PPSSTEALNDSQEFPFPETPTKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTLD PTRDQCFGDRFSRLLLDEFLGYDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMA RTSYLAAFAIMVIFTLSVSMLLRYSHHQIFVFIVDLLQMLEMNMAIAFPAAPLLTVILAL VGMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTSTSKRHWLRFFYLYHFAFYAYHY RFNGQYSSLALVTSWLFIQHSMIYFFHHYELPAILQQVRIQEMLLQAPPLGPGTPTALPD DMNNNSGAPATAPDSAGQPPALGPVSPGASGSPGPVAAAPSSLVAAAASVAAAAGGDLGW MAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAA VGGPSPASMAPTEAPSEVGS
Uniprot No.

Target Background

Function
Membralin may play a role in the endoplasmic reticulum-associated degradation (ERAD) pathway, facilitating the clearance of misfolded proteins within the endoplasmic reticulum (ER). It may also contribute to motor neuron survival, potentially by mitigating ER stress.
Gene References Into Functions
  1. Genomic organization and expression (membralin): PMID: 12638133
  2. This study presents the first characterization of human membralin, suggesting its potential as a novel tumor-associated marker in ovarian serous carcinomas: PMID: 16084606
Database Links

HGNC: 17039

OMIM: 611011

KEGG: hsa:91304

UniGene: Hs.515003

Protein Families
Membralin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Human Membralin and what are its alternative nomenclatures?

    Human Membralin, encoded by the TMEM259 gene, is an evolutionarily conserved endoplasmic reticulum (ER) membrane protein. It is also known as C19orf6 or Transmembrane Protein 259. The protein has a predicted molecular weight of approximately 68 kDa and is expressed in multiple human cell types including K562, THP1, and HL60 cells . Membralin functions as a component of the ER-associated degradation (ERAD) machinery, which is critical for the clearance of misfolded proteins in the endoplasmic reticulum. As an integral component of the ER membrane, Membralin plays essential roles in cellular protein homeostasis and quality control mechanisms .

  • What cellular functions has Membralin been implicated in?

    Membralin serves multiple crucial cellular functions primarily centered around protein quality control. It is a key component of the ERAD (Endoplasmic Reticulum-Associated Degradation) pathway required for clearance of misfolded proteins in the endoplasmic reticulum . Specifically, Membralin has been identified as a novel component of the ERAD machinery that regulates the turnover of nicastrin, a key subunit of the γ-secretase complex . Through this mechanism, Membralin influences γ-secretase activity, which has implications for Alzheimer's disease pathogenesis. Additionally, Membralin promotes the survival of motor neurons, likely by protecting against ER stress . In astrocytes, Membralin regulates glutamate homeostasis by modulating the expression of the astrocytic glutamate transporter EAAT2 through the TNF-α/TNFR1/NFκB pathway .

  • What disease associations have been established for Membralin dysfunction?

    Membralin dysfunction has been associated with several neurological disorders. Most prominently, reduced Membralin expression has been observed in human Amyotrophic Lateral Sclerosis (ALS) spinal cord samples and SOD1-mutant mouse models of ALS, indicating its potential role in ALS pathogenesis . The reduction in Membralin levels correlates with decreased EAAT2 expression and disease progression in ALS models. Additionally, Membralin deficiency leads to glutamatergic neurotoxicity, suggesting its involvement in excitotoxicity-related neurodegeneration . The TMEM259 gene has also been linked to Congenital Disorder Of Deglycosylation 1, further highlighting its importance in protein processing and quality control . The neuroprotective role of Membralin makes it a potential therapeutic target for neurodegenerative diseases characterized by ER stress and protein misfolding.

  • What are the known protein-protein interactions involving Membralin?

    Membralin engages in several critical protein-protein interactions as part of its function in the ERAD pathway. In plants (which offers insight into potential conserved interactions in humans), Membralin specifically interacts with RING domain-containing E3-ubiquitin ligases RNF185 and RNF5, forming a distinct branch of the ERAD pathway that operates independently of the classical HRD1 and Doa10 ERAD complexes . In the mammalian system, Membralin has been demonstrated to mediate the turnover of nicastrin, a crucial subunit of the γ-secretase complex, indicating direct or indirect interactions with components of this complex . Additionally, through its influence on the TNF-α/TNFR1/NFκB pathway, Membralin likely interfaces with components of this signaling cascade to regulate EAAT2 expression in astrocytes . These interactions collectively position Membralin as a central regulator of protein quality control and stress response pathways.

Experimental Design and Troubleshooting

  • What experimental controls are essential when studying the impact of Membralin on glutamate homeostasis?

    When investigating Membralin's impact on glutamate homeostasis, the following controls are essential to ensure robust and interpretable results:

    Genetic Controls:

    • Wild-type matched controls from the same genetic background

    • Heterozygous Membralin deletion models to assess gene dosage effects

    • Rescue experiments with Membralin re-expression (as demonstrated with Prion-mem and Hb9-mem transgenic lines)

    Cellular Controls:

    • Cell-type specific deletion models to isolate effects (astrocyte-specific vs. neuron-specific)

    • Co-culture experiments with defined cellular ratios to control for paracrine influences

    • Time-course analysis to distinguish immediate from progressive effects

    Methodological Controls:

    Experiment TypeEssential ControlPurpose
    Glutamate uptake assaysCompetitive inhibitors (e.g., TFB-TBOA)Confirm EAAT2 specificity
    EAAT2 expression analysisMultiple reference genesEnsure normalization accuracy
    Excitotoxicity assessmentNMDA receptor antagonistsVerify glutamate receptor dependence

    Pharmacological Validation:

    • TNF-α pathway inhibitors to confirm the proposed mechanism

    • Proteasome inhibitors to verify ERAD pathway involvement

    • Glutamate receptor antagonists to confirm excitotoxicity mechanisms

    Without these controls, it would be impossible to distinguish direct effects of Membralin on glutamate homeostasis from secondary consequences or compensatory mechanisms.

  • How can contradictory findings in Membralin research be reconciled and explained?

    Research on Membralin has occasionally produced seemingly contradictory findings that require careful interpretation:

    Cell Type Specificity Considerations:

    • Membralin deletion in different CNS cell types yields variable phenotypes

    • While global or astrocytic deletion causes severe motor defects and neonatal lethality, deletion in motor neurons (Hb9-Cre) produces minimal phenotypic abnormalities

    • This apparent contradiction is resolved by understanding the non-cell-autonomous effects of astrocytic Membralin on motor neuron survival

    Timing and Developmental Context:

    • No phenotype is observed with Membralin deletion at P0, but progressive deterioration occurs postnatally

    • This temporal specificity suggests context-dependent functions that may appear contradictory if developmental timing is not considered

    Methodological Reconciliation Framework:

    1. Evaluate experimental models (in vitro vs. in vivo, acute vs. chronic)

    2. Consider species differences (mouse vs. human, differences in compensatory mechanisms)

    3. Assess measurement techniques (direct vs. indirect assessments of Membralin function)

    4. Examine genetic background effects that may modify phenotypic manifestations

    Example Resolution:
    The seemingly paradoxical finding that motor neuron-specific Membralin expression (Hb9-mem) failed to rescue membrane knockout phenotypes while CNS-wide expression (Prion-mem) was effective is explained by recognizing that the primary site of Membralin's protective action is in astrocytes rather than motor neurons themselves.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.