Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human PGRMC2

Recombinant Human PGRMC2 (Membrane-Associated Progesterone Receptor Component 2) is a synthetic version of the endogenous PGRMC2 protein, produced via heterologous expression systems such as HEK293T cells, wheat germ, or baculovirus-infected insect cells . This recombinant protein retains the functional domains of its native counterpart, including a cytochrome b5-like heme-binding domain and a transmembrane region critical for progesterone signaling . PGRMC2 is part of the MAPR (membrane-associated progesterone receptor) family and plays roles in steroid signaling, heme metabolism, and cellular homeostasis .

Recombinant PGRMC2 Production and Applications

Recombinant PGRMC2 is engineered for research purposes, including:

ParameterValue/DescriptionSource
Expression SystemHEK293T cells, wheat germ, or baculovirus-infected insect cells
TagC-Myc/DDK (Boster), no tag (Abcam)
Purity>80% (SDS-PAGE)
Concentration>50 µg/mL (BCA method)
Storage-80°C (liquid) or -20°C/-80°C (lyophilized)

Applications:

  • Cell signaling studies: Progesterone-dependent sperm acrosome reaction and adipocyte function .

  • Cancer research: Inhibition of ovarian cancer cell migration and potential metastasis suppression .

  • Antibody validation: Used as a control fragment for immunogen blocking experiments .

Biological Functions and Pathways

PGRMC2 interacts with multiple pathways and processes:

Heme and Steroid Signaling

  • Heme chaperone: Delivers labile heme to nuclear transcription factors, modulating lipid metabolism and oxidative stress responses .

  • Progesterone signaling: Acts as a non-classical progesterone receptor, influencing uterine development and neuroprotection .

Metabolic Regulation

  • Adipose tissue: Regulates glucose homeostasis in brown fat via NR1D1/BACH1 repression .

  • Ovarian function: Linked to ovarian reserve status and endometriosis pathogenesis .

Disease Associations

  • Reproductive disorders: Achalasia-Addisonianism-Alacrima Syndrome and endometriosis .

  • Cancer: Overexpression in ovarian tumors and metastasis suppression in endocervical adenocarcinomas .

Reproductive and Neurological Roles

  • Uterine histoarchitecture: Maintains endometrial structure during the secretory phase .

  • Neuroprotection: Progesterone-PGRMC2 signaling suppresses GnRH neuronal activity via calcium oscillation inhibition .

Metabolic and Immune Functions

  • Glucose regulation: In brown fat, heme delivery by PGRMC2 modulates circadian rhythm genes .

  • Immune homeostasis: Co-regulates maternal-fetal immune interactions with HLA-G .

Challenges and Future Directions

While recombinant PGRMC2 has advanced functional studies, limitations include:

  • Partial structural data: Full-length recombinant proteins are rare (e.g., Abcam’s 1-223 aa construct) .

  • Tissue-specific effects: Conflicting roles in cancer (migration inhibition vs. survival promotion) require further elucidation .

  • Therapeutic potential: Targeting PGRMC2 for endometriosis or metabolic disorders remains unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
PGRMC2; DG6; PMBP; Membrane-associated progesterone receptor component 2; Progesterone membrane-binding protein; Steroid receptor protein DG6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
PGRMC2
Target Protein Sequence
MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVAL VALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRIL LAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQM ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Uniprot No.

Target Background

Function
PGRMC2 is essential for maintaining uterine histoarchitecture and normal female reproductive lifespan. It may function as a ubiquitous non-classical progesterone receptor in the uterus. Furthermore, it acts as an intracellular heme chaperone, delivering labile or signaling heme to the nucleus. PGRMC2 also plays a role in adipocyte function and systemic glucose homeostasis. In brown adipose tissue, which exhibits high heme demand, nuclear delivery of labile heme regulates heme-responsive transcriptional repressors, such as NR1D1 and BACH1.
Gene References Into Functions
  1. Demonstrates altered myometrium PGRMC1 expression and changes in PGRMC1 and PGRMC2 cellular localization associated with parturition. PMID: 25266650
  2. Suggests a potential role for PGRMC2 as a tumor suppressor, migration inhibitor, and regulator of cytochrome P450 proteins, warranting further investigation. PMID: 23276631
  3. Reports downregulated PGRMC-2 expression in secretory phase endometrium from women with advanced-stage endometriosis. PMID: 23793472
  4. Observes increased PGRMC1 and PGR levels, but decreased PGRMC2 levels, in HO-8910 cells treated with CDDP. PMID: 23970345
  5. Shows that PGRMC2 inhibits the in vitro migration of SKOV-3 ovarian cancer cells. PMID: 23064006
  6. Investigates the expression of a novel progesterone-binding protein (hmPR1/PGMRC1) detected in human sperm. PMID: 15702432
Database Links

HGNC: 16089

OMIM: 607735

KEGG: hsa:10424

STRING: 9606.ENSP00000429301

UniGene: Hs.507910

Protein Families
Cytochrome b5 family, MAPR subfamily
Subcellular Location
Membrane; Single-pass membrane protein. Nucleus envelope. Endoplasmic reticulum.
Tissue Specificity
Expressed by endometrial glands and stroma (at protein level).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.