Recombinant Human Membrane progestin receptor beta (PAQR8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
PAQR8; C6orf33; LMPB1; MPRB; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and adipoQ receptor family member 8; Progestin and adipoQ receptor family member VIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
PAQR8
Target Protein Sequence
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Uniprot No.

Target Background

Function
Plasma membrane progesterone (P4) receptor coupled to G proteins. It appears to function through a G(i)-mediated pathway and may play a role in oocyte maturation. It also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone, and allopregnanolone.
Gene References Into Functions
  1. LMPB1 is an integral membrane protein localized to lysosomal structures. PMID: 11676489
  2. Heterologous expression of MPRB in yeast confirms its function as a membrane progesterone receptor. PMID: 18603275
Database Links

HGNC: 15708

OMIM: 607780

KEGG: hsa:85315

STRING: 9606.ENSP00000353953

UniGene: Hs.239388

Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the hypothalamus. Also expressed in spinal cord, kidney and testis.

Q&A

What is PAQR8 and what are its basic structural characteristics?

PAQR8, also known as membrane progesterone receptor beta (mPRβ), is a member of the progestin and adipoQ receptor (PAQR) family. Based on computational predictions, PAQR8 is a 7-transmembrane protein with an extracellular N-terminus and intracellular C-terminus resembling G protein-coupled receptors (GPCRs) . The protein contains three conserved motifs that resemble those in the alkaline ceramidase family with respect to both sequence and location, suggesting potential enzymatic function . PAQR8 expression has been detected in various cell types, including normal and malignant breast, ovarian, and myometrial cells .

How does PAQR8 signaling work at the molecular level?

PAQR8 signaling appears to function through multiple mechanisms:

  • G protein coupling: Evidence suggests that PAQR8 couples to inhibitory G (Gi) proteins, leading to decreased intracellular cAMP levels . This Gi protein-dependent mechanism is sensitive to pertussis toxin (PTX), which is a potent inhibitor of GPCRs coupled to Gi proteins.

  • Sphingolipid metabolism: PAQR8 alters the balance of ceramides and sphingolipids, specifically decreasing ceramide levels while increasing sphingosine-1-phosphate levels . This shift generally promotes cell survival, as ceramides are pro-apoptotic while sphingosine-1-phosphate supports proliferation.

  • Progesterone independence: Interestingly, the pro-survival effects mediated by PAQR8 do not appear to require progesterone binding . This suggests that PAQR8 may have constitutive activity or respond to other unidentified ligands.

The integration of these signaling pathways contributes to PAQR8's biological effects, particularly in the context of cancer cell survival and therapy resistance.

How is PAQR8 expression regulated in normal tissues versus disease states?

In normal tissues, PAQR8 expression has been documented in various cell types, but its regulation under physiological conditions is not fully characterized. In disease states, particularly cancer, multiple regulatory mechanisms have been identified:

  • Copy number alterations: PAQR8 undergoes copy number (CN) gain preferentially in recurrent breast tumors compared to primary tumors . This genomic amplification contributes to increased PAQR8 expression levels.

  • Spontaneous upregulation: Studies in mouse models have demonstrated that PAQR8 is spontaneously upregulated in post-therapy recurrent tumors across multiple cancer types .

  • Age-related differences: Research has shown age-dependent differences in PAQR8 expression in neural tissues, suggesting developmental or aging-related regulation .

The mechanisms driving these expression changes remain incompletely understood, but likely involve both genetic alterations and adaptive responses to therapeutic interventions.

What evidence supports PAQR8's role in breast cancer recurrence?

Multiple lines of evidence implicate PAQR8 in breast cancer recurrence:

This convergent evidence from human cohorts, animal models, and in vitro experiments strongly supports PAQR8's role as a driver of breast cancer recurrence.

How does PAQR8 contribute to therapy resistance in breast cancer?

PAQR8 promotes resistance to multiple therapeutic modalities through several mechanisms:

  • Enhanced cell survival: PAQR8 enhances tumor cell survival following:

    • Estrogen receptor pathway inhibition (fulvestrant or estrogen deprivation)

    • HER2 pathway blockade (lapatinib or HER2 downregulation)

    • Chemotherapeutic agents

  • cAMP modulation: PAQR8's pro-survival effects are mediated by a Gi protein-dependent reduction in cAMP levels . Lower cAMP levels typically activate pro-survival signaling pathways.

  • Sphingolipid balance alteration: PAQR8 decreases ceramide levels while increasing sphingosine-1-phosphate levels . This shift in sphingolipid balance favors cell survival, as ceramides promote apoptosis while sphingosine-1-phosphate supports proliferation.

  • Progesterone-independent activity: Unlike classical progesterone receptors, PAQR8's effects on therapy resistance do not require progesterone , suggesting constitutive activity or response to alternative ligands.

This multifaceted approach to promoting cell survival likely explains PAQR8's ability to confer resistance across diverse therapeutic modalities.

What is the relationship between PAQR8 and other known resistance mechanisms in breast cancer?

PAQR8 appears to function in parallel with other established resistance mechanisms:

  • ESR1 mutations: In the METAMORPH cohort, PAQR8 CN gain in recurrent tumors was mutually exclusive with activating ESR1 mutations in patients treated with anti-estrogen therapies . This pattern suggests that PAQR8 and ESR1 mutations represent alternative routes to achieving similar resistance phenotypes.

  • PGR mutations: PAQR8 CN gain was also mutually exclusive with mutations in PGR (progesterone receptor) , further supporting its role in hormonal pathway dysregulation.

  • Survival outcomes: Patients whose recurrent tumors harbored PAQR8 gain had survival outcomes comparable to those with ESR1 activating mutations , indicating similar clinical impacts.

The fact that PAQR8 CN gain occurs with equal frequency among patients treated with various therapies (endocrine therapy, chemotherapy, anti-HER2 agents) suggests it represents a more generalized resistance mechanism compared to therapy-specific alterations like ESR1 mutations.

What are the recommended methods for detecting PAQR8 copy number alterations in tumor samples?

Based on the methodologies described in the literature, the following approaches are recommended for detecting PAQR8 copy number alterations:

  • Shallow whole genome sequencing:

    • 75 bp single-end reads, approximately 30.1 million reads on average (0.9X coverage)

    • Alignment using Burrows-Wheeler Aligner (BWA)

    • Copy number signal quantification using QDNAseq

    • Copy number normalization using ACE

  • Threshold definitions:

    • Low-level CN gains: ≥ 2.12 (representing copy number calls above the threshold containing > 99% of copy number calls in normal tissue samples)

    • High-level CN gain: ≥ 2.9 (encompassing the majority of the CN distribution peak at CN = 3)

    • Low-level gains typically represent subclonal CN events

    • High-level gains represent either clonal +1 CN events or subclonal >+1 CN events

  • Statistical analysis:

    • Compare frequencies of CN gain between primary and recurrent tumors using one-sided Fisher's exact test

    • For clinical correlation studies, use Cox proportional hazards regression to assess associations between PAQR8 gain and survival outcomes

These methodological approaches provide sensitive and specific detection of PAQR8 copy number alterations in both research and clinical samples.

What experimental systems are most effective for studying PAQR8 function in cancer?

Several experimental systems have proven valuable for investigating PAQR8 function:

  • Genetically engineered mouse models (GEMs):

    • Bitransgenic doxycycline-inducible models (e.g., MMTV-rtTA and TetO-driven oncogenes)

    • These models recapitulate key elements of breast cancer progression including:

      • Primary tumor formation

      • Tumor regression following oncogene downregulation

      • Cellular dormancy in residual tumor cells

      • Spontaneous tumor recurrence

  • Cell line models:

    • Manipulation of PAQR8 expression via:

      • Lentiviral overexpression using modified pUltra plasmids with H2B-eGFP and H2B-mCherry markers

      • CRISPR/Cas9 knockout using LRG2.1 or LRmCherry2.1 vectors

    • Functional assays:

      • Colony formation

      • Cell viability

      • Relative cell fitness

      • Immunofluorescence staining for markers of apoptosis and proliferation

  • Primary patient-derived samples:

    • Analysis of paired primary and recurrent tumors

    • Correlation of PAQR8 status with clinical outcomes and other genomic alterations

Each system offers distinct advantages, with mouse models providing in vivo recurrence data, cell lines enabling mechanistic studies, and patient samples ensuring clinical relevance.

What techniques are recommended for measuring PAQR8-mediated changes in sphingolipid metabolism?

Based on the literature, the following methodologies are recommended for analyzing PAQR8's effects on sphingolipid metabolism:

  • Sample preparation:

    • Inactivate enzymes by adding 1 mL of 80% methanol to cell culture plates

    • Include multiple technical replicates (minimum 5) for each experimental condition

    • Use one sample for protein quantification to enable normalization

  • Sphingolipid extraction:

    • Follow established extraction protocols optimized for lipid isolation

    • Ensure complete extraction of both polar and non-polar sphingolipid species

  • Analysis by liquid chromatography-high resolution mass spectrometry:

    • Separate sphingolipid species by liquid chromatography

    • Identify and quantify using high-resolution mass spectrometry

    • Focus on key sphingolipid species including:

      • Ceramides (various chain lengths)

      • Sphingosine

      • Sphingosine-1-phosphate

      • Sphinganine

      • Sphinganine-1-phosphate

  • Data normalization and analysis:

    • Normalize sphingolipid levels to protein content

    • Use appropriate statistical tests (e.g., two-tailed Student's t-tests) to assess differences between groups

    • For non-normally distributed data (determined by Shapiro-Wilk test), employ Mann-Whitney U test

These techniques provide comprehensive profiling of sphingolipid alterations induced by PAQR8, offering insights into its potential ceramidase activity and downstream effects on cell survival.

How can researchers investigate the proposed ceramidase activity of PAQR8?

Investigating PAQR8's potential ceramidase activity requires multiple complementary approaches:

  • Structure-function analysis:

    • Create site-directed mutants targeting the three conserved motifs shared with the alkaline ceramidase family

    • Express these mutants in appropriate model systems to assess functional consequences

    • Compare the effects of these mutations on both sphingolipid metabolism and downstream biological outcomes

  • Direct enzymatic assays:

    • Develop in vitro assays using purified PAQR8 protein

    • Utilize fluorescent or radiolabeled ceramide substrates

    • Measure ceramide hydrolysis and formation of sphingosine

    • Compare enzymatic parameters (Km, Vmax) with known ceramidases

  • Cellular sphingolipid profiling:

    • Manipulate PAQR8 expression (overexpression, knockdown, knockout)

    • Perform comprehensive sphingolipidomic analysis by liquid chromatography-high resolution mass spectrometry

    • Focus on changes in ceramide species and their metabolites (sphingosine, sphingosine-1-phosphate)

    • Conduct time-course experiments to capture enzymatic conversion dynamics

  • Competitive inhibition studies:

    • Test whether known ceramidase inhibitors affect PAQR8-mediated sphingolipid changes

    • Assess if exogenous ceramidase supplementation rescues phenotypes in PAQR8-deficient models

    • Determine if ceramide supplementation overcomes PAQR8-mediated therapy resistance

This multifaceted approach can provide definitive evidence regarding PAQR8's proposed ceramidase activity and its relevance to cancer biology.

What is known about the progesterone-independent functions of PAQR8, and how can they be studied?

The progesterone-independent functions of PAQR8 represent an important research area with several investigative approaches:

  • Ligand-binding studies:

    • Develop assays to assess binding of progesterone and other potential ligands to PAQR8

    • Create PAQR8 mutants with disrupted progesterone binding sites based on homology with related receptors (e.g., PAQR7)

    • Test whether these mutations affect downstream signaling and biological functions

  • Hormone-deprivation experiments:

    • Utilize charcoal-stripped serum and hormone-free culture conditions

    • Compare PAQR8 activities in presence versus absence of progesterone

    • Assess whether PAQR8's effects on cell survival, therapy resistance, and sphingolipid metabolism persist in progesterone-free conditions

  • Constitutive activity assessment:

    • Examine basal signaling activities (cAMP levels, sphingolipid metabolism) in cells expressing PAQR8

    • Compare with related receptors that require ligand activation

    • Investigate structural features that might confer constitutive activity

  • Alternative ligand screening:

    • Test whether other steroid hormones, lipid mediators, or small molecules can activate PAQR8

    • Develop reporter assays that measure downstream signaling events (cAMP reduction, sphingolipid alterations)

    • Screen compound libraries to identify novel PAQR8 modulators

Current evidence suggests that PAQR8's pro-survival effects in cancer cells are mediated by a Gi protein-dependent reduction in cAMP levels and do not require progesterone . This progesterone independence distinguishes PAQR8 from classical progesterone receptors and may contribute to its role in therapy resistance.

How does PAQR8 interact with G proteins, and what methods can address this relationship?

Investigating PAQR8's interaction with G proteins, particularly Gi proteins, requires specialized approaches:

  • Pertussis toxin (PTX) sensitivity assays:

    • Treat cells with PTX, which ADP-ribosylates and inactivates Gi proteins

    • Assess whether PAQR8-mediated effects (cAMP reduction, cell survival, sphingolipid alterations) are abolished by PTX treatment

    • This approach provides functional evidence for Gi protein coupling

  • Direct interaction studies:

    • Perform co-immunoprecipitation of PAQR8 with various G protein subunits

    • Use proximity ligation assays to detect PAQR8-G protein interactions in intact cells

    • Employ BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer) to monitor real-time interactions

  • Downstream signaling analysis:

    • Measure cAMP levels using ELISA or FRET-based sensors in response to PAQR8 activation

    • Examine phosphorylation of downstream effectors typically modulated by Gi protein signaling

    • Assess calcium mobilization and other second messenger responses

  • Structural studies:

    • Develop computational models of PAQR8-G protein interactions based on crystal structures of related GPCRs

    • Identify potential G protein binding domains through homology modeling

    • Create mutants with altered G protein binding sites and test their signaling capabilities

What is the role of PAQR8 in neurological systems and pain mechanisms?

PAQR8's functions in neurological systems are beginning to emerge as an important research area:

  • Expression patterns:

    • PAQR8 expression has been detected in the ventral tegmental area (VTA), a key region involved in pain processing and reward circuits

    • Age-dependent differences in PAQR8 expression have been observed in neural tissues, with significant differences between young and old rats

  • Pain modulation:

    • VZV (varicella-zoster virus) injection, which induces pain-like behavior in animal models, significantly affects PAQR8 protein levels

    • A significant interaction between VZV treatment and age has been observed in PAQR8 expression

    • Young rats injected with VZV show significant differences in PAQR8 expression compared to young control rats, while this difference is not observed in older animals

  • Experimental approaches:

    • Place escape/avoidance paradigm (PEAP) test can be used to assess pain responses in relation to PAQR8 expression

    • RNA expression analysis and protein quantification in specific brain regions provide insights into PAQR8's neurological functions

    • Age comparisons are critical, as PAQR8 expression and response to stimuli appear to be age-dependent

This emerging area requires further investigation to understand how PAQR8's known molecular functions (G protein coupling, sphingolipid metabolism) might contribute to pain perception and processing across different age groups.

PAQR8 copy number status and clinical outcomes in breast cancer patients

Data compiled from studies cited in search results .

Comparison of PAQR8 to other resistance mechanisms in breast cancer

FeaturePAQR8 CN GainESR1 MutationsPGR Mutations
Frequency in recurrent tumorsCommon (>50% of patients)Up to 20% of patientsLess common
Treatment contextMultiple therapies (endocrine, chemo, anti-HER2)Almost exclusively in aromatase inhibitor-treated patientsVarious
Mutual exclusivity patternMutually exclusive with ESR1 and PGR mutationsMutually exclusive with PAQR8 CN gainMutually exclusive with PAQR8 CN gain
Survival impactPoor survival after recurrenceSimilar to PAQR8 CN gainSimilar to PAQR8 CN gain
MechanismG protein signaling, sphingolipid metabolismConstitutive ER activationAltered progesterone signaling

Data compiled from studies cited in search results .

PAQR8 expression changes in neurological tissues by age and VZV treatment

Age GroupTissueControl ExpressionVZV Treatment ExpressionStatistical Significance
Young ratsVTAReference levelSignificantly increasedp < 0.05
Old ratsVTASimilar to young ratsNo significant change vs. controlNot significant
Young vs. Old (Control)VTANo significant differenceN/ANot significant
Young vs. Old (VZV-treated)VTAN/ASignificant differencep < 0.05

Data compiled from studies cited in search results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.