Recombinant Human Membrane-spanning 4-domains subfamily A member 10 (MS4A10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human MS4A10

Recombinant Human Membrane-spanning 4-domains subfamily A member 10 (MS4A10), also known as CD20L7 or MS4A9, is a synthetic protein derived from the human MS4A10 gene. It belongs to the MS4A family of transmembrane proteins, characterized by four hydrophobic domains and cytoplasmic termini . These proteins are typically expressed in immune cells and non-hematopoietic tissues, with roles in signaling, differentiation, and disease susceptibility . Recombinant MS4A10 is produced via cell-free expression systems or bacterial/yeast hosts, with purity ≥85% as validated by SDS-PAGE .

Tissue and Cellular Expression

MS4A10 exhibits tissue-specific expression, with notable presence in:

Tissue/OrganCellular Targets/Expression EvidenceSource
KidneyDetected in renal tissue
TonsilLymphoid tissue expression
Lymph nodesHematopoietic cell expression
Small intestineEpithelial and immune cell expression
TestisStrong cytoplasmic-membranous positivity in germ cells
BDCA4+ DCsDendritic cell subset
CD14+ MonocytesMyeloid lineage cells

Research Applications and Recombinant Products

Recombinant MS4A10 is utilized in diverse experimental workflows, including:

Table 1: Recombinant MS4A10 and Related Products

Product TypeHost/ReactivityPurityApplicationsSource
Recombinant Human MS4A10Cell-free≥85% (SDS-PAGE)Protein interaction studies, signaling assays
Recombinant Mouse MS4A10Cell-free≥85% (SDS-PAGE)Cross-species comparative studies
Human MS4A10 ELISA KitHumanN/AQuantitative protein detection
MS4A10 siRNA (Human)Synthetic>97%Gene silencing in human cells
Polyclonal AntibodyHumanN/AImmunohistochemistry, Western blotting

Key Applications:

  • Immunohistochemistry: MS4A10 antibodies (e.g., PA5-53233) detect strong cytoplasmic-membranous staining in testicular germ cells .

  • RNA Interference: siRNA targeting MS4A10 enables functional knockdown in immune cells .

Functional Insights and Disease Associations

While MS4A10’s precise function remains unclear, family members (e.g., MS4A1, MS4A4A) regulate calcium signaling, immune cell activation, and tumor microenvironments . Emerging evidence links MS4A10 to:

Disease/CancerAssociationSource
Gastric CancerElevated expression in gastric adenocarcinoma
Colorectal CancerDetected in primary and metastatic tumors
Immune RegulationPotential role in macrophage or dendritic cell polarization

Mechanistic Hypotheses:

  • Ion channel activity: Likely involvement in calcium signaling, analogous to MS4A4A and MS4A12 .

  • Immune modulation: May influence tumor-associated macrophage (TAM) polarization, impacting immunotherapy efficacy .

Clinical and Therapeutic Relevance

MS4A10’s role in cancer progression and immune regulation positions it as a potential biomarker or therapeutic target:

  • Cancer Biomarker: Overexpression in gastric and colorectal cancers suggests diagnostic utility .

  • Immunotherapy: Modulating MS4A10 could enhance immune checkpoint inhibitor efficacy by altering TAM phenotypes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MS4A10; CD20L7; MS4A9; Membrane-spanning 4-domains subfamily A member 10; CD20 antigen-like 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MS4A10
Target Protein Sequence
MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKEL GAFHITIALLHLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYL KMLCLMTNLISLFCVLSGLFVISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVL ELFLPVPTAVTAWRGDCPSAKNDDACLVPNTPLHLKGLPVEPPPSYQSVIQGDAQHKQHQ RLREVKQVAPDTWIVTDGAAIWTQTAN
Uniprot No.

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Database Links

HGNC: 13368

OMIM: 608403

KEGG: hsa:341116

STRING: 9606.ENSP00000311862

UniGene: Hs.591956

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MS4A10 and what structural features characterize this protein?

MS4A10 (membrane-spanning 4-domains, subfamily A, member 10) is a member of the MS4A gene family encoding proteins with at least four potential transmembrane domains and N- and C-terminal cytoplasmic domains encoded by distinct exons. The protein contains structural features common to the MS4A family, which are related to cell surface proteins like CD20 and the high-affinity IgE receptor beta chain (FcεRIβ) . MS4A10 is clustered with other MS4A genes along an approximately 600-kb region on Chromosome 11q12 . Unlike some other MS4A proteins, MS4A10 transcripts are relatively rare and not commonly detected among hematopoietic cells and most nonlymphoid tissues, suggesting tissue-specific expression patterns .

How does MS4A10 relate to other members of the MS4A family?

MS4A10 is one of at least 12 identified human MS4A gene family members (MS4A1-MS4A12) . The MS4A family currently includes 24 distinct human and mouse genes that share common structural features and similar intron/exon splice boundaries . While most MS4A genes encode proteins with at least four transmembrane domains, some variants like MS4A6E contain only two transmembrane domains . Unlike MS4A2, MS4A4A, MS4A6A, MS4A7, and other family members that show differential expression in various tissues and correlation with disease states (such as lung cancer), MS4A10 shows a more restricted expression pattern . Like other MS4A family members, MS4A10 is likely a component of oligomeric cell surface complexes involved in signal transduction pathways in specific cell lineages .

What is the genomic location and basic expression pattern of MS4A10?

MS4A10 (NCBI Gene ID: 341116) is located in the MS4A gene cluster on human chromosome 11q12, an area spanning approximately 600 kb that contains multiple MS4A family members . Unlike some other MS4A family genes that are widely expressed in hematopoietic cells, MS4A10 transcripts are rare and show a more restricted expression pattern . The gene's expression can be analyzed through resources like the Allen Brain Atlas, BioGPS Human Cell Type and Tissue Gene Expression Profiles, and CCLE Cell Line Gene CNV Profiles . According to functional association data, MS4A10 has 942 functional associations with biological entities spanning 8 categories, including molecular profiles, functional terms, chemicals, diseases, phenotypes, structural features, cell types/tissues, and other genes/proteins .

What are effective methods for MS4A10 gene knockdown in research models?

For effective MS4A10 knockdown, siRNA-mediated gene silencing provides a reliable approach. When conducting knockdown experiments:

  • Select a validated siRNA oligos set targeting human MS4A10 (e.g., targeting accession number NM_206893.4) .

  • Consider using a set of multiple siRNA constructs (typically 3-4 different sequences) to increase the probability of achieving significant knockdown, as the effect of individual siRNAs can vary by cell type and experimental conditions .

  • Transfect the siRNA oligos at appropriate concentrations (typically 20-50 nM) using standard transfection reagents like Lipofectamine for transient expression .

  • For stable knockdown, lentiviral vectors carrying shRNA sequences targeting MS4A10 may be more appropriate .

  • Always include appropriate controls such as scrambled siRNA sequences to assess specificity .

  • Assess knockdown efficiency by qPCR at least 48 hours post-transfection, with monitoring possible up to 72 hours for optimal results .

  • Verify protein knockdown by western blot if antibodies are available.

For experiments requiring long-term knockdown, consider using CRISPR-Cas9 technology as an alternative to siRNA approaches.

How should recombinant MS4A10 protein be stored and handled for maximum stability?

For optimal stability and functionality of recombinant MS4A10 protein:

  • Store lyophilized protein at -70°C for long-term storage or at -20°C for short-term storage .

  • Maintain reconstituted protein at concentrations above 20μM to prevent degradation .

  • Upon reconstitution, divide the protein into small aliquots to avoid repeated freeze-thaw cycles, which can reduce activity by approximately 5% per cycle .

  • When handling transmembrane proteins like MS4A10, use appropriate detergents or amphipols to maintain proper protein folding and prevent aggregation.

  • Always perform stability tests under your specific laboratory conditions, as membrane proteins can be particularly sensitive to buffer composition, pH, and temperature fluctuations.

  • Consider adding protease inhibitors to prevent degradation during experimental procedures.

  • For functional assays, verify protein activity promptly after reconstitution for best results.

What expression systems are most suitable for producing recombinant human MS4A10?

When selecting an expression system for recombinant human MS4A10 production, consider the following options based on experimental needs:

Expression SystemAdvantagesLimitationsBest For
Mammalian (HEK293, CHO)Native post-translational modifications, proper folding of complex transmembrane domainsHigher cost, lower yieldFunctional studies, antibody production
Insect (Sf9, Hi5)Higher yield than mammalian, supports most post-translational modificationsSome differences in glycosylation patternsStructural studies, high-yield requirements
E. coliHigh yield, cost-effective, rapidLimited post-translational modifications, refolding often requiredDomain studies, peptide production
Cell-free systemsAvoids toxicity issues, rapid, control over redox conditionsLower yield, higher costDifficult-to-express variants, rapid screening

How is MS4A10 expression altered in cancer and other pathological conditions?

While the specific role of MS4A10 in cancer is not fully characterized in the provided search results, insights can be drawn from studies of the broader MS4A family:

Several MS4A family members show altered expression in lung cancer tissues compared to normal tissues. For example, MS4A2, MS4A4A, MS4A4E, MS4A6A, MS4A6E, MS4A7, MS4A8, MS4A14, and MS4A15 were significantly decreased in lung cancer tissues . Among these, MS4A2, MS4A8, and MS4A15 showed significant correlation with the pathological stage of lung cancer patients . Lower mRNA expression levels of MS4A2, MS4A4E, and MS4A15 were associated with poorer prognosis in lung cancer patients .

For MS4A10 specifically, researchers should investigate:

  • Expression patterns across different cancer types using resources like the CCLE Cell Line Gene CNV Profiles

  • Correlation with prognostic indicators in various cancer types

  • Potential associations with immune infiltration signatures, as the MS4A family functions are primarily involved in immune-related pathways

  • Possible roles in specific signaling cascades related to cell proliferation or immune response

What signaling pathways involve MS4A10 and how can they be studied?

Based on its structural similarity to other MS4A family members, MS4A10 likely functions in oligomeric cell surface complexes involved in signal transduction . To study MS4A10 signaling pathways:

  • Perform co-immunoprecipitation experiments to identify protein interaction partners of MS4A10

  • Use phosphoproteomics approaches to identify downstream signaling events following MS4A10 activation or inhibition

  • Employ pathway analysis tools to map MS4A10 interactions using the 942 functional associations spanning 8 biological entity categories reported for this protein

  • Investigate if MS4A10, like other family members, influences immune-related pathways, as several MS4A proteins correlate with immune cell infiltration (B cells, CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and dendritic cells)

  • Conduct comparative signaling studies with other MS4A family members that have better-characterized pathways

  • Use RNA-seq analysis after MS4A10 knockdown or overexpression to identify affected gene networks

A systems biology approach combining multiple techniques will likely yield the most comprehensive understanding of MS4A10 signaling networks.

What is the relationship between MS4A10 and immune cell function?

The MS4A family shows significant connections to immune system function, with several members expressed predominantly in immune cells . While MS4A10 specifically shows limited expression in hematopoietic cells compared to other family members , investigating its potential immune functions remains important:

  • Expression analysis indicates that unlike other MS4A genes, MS4A10 transcripts are rare in hematopoietic cells, suggesting a potentially specialized function in specific immune cell subsets or non-immune tissues

  • Several MS4A family members (including MS4A2, MS4A4A, MS4A6A, MS4A7) show correlation with immune cell infiltration in cancer, suggesting potential immunomodulatory roles

  • The founding members of the MS4A family (CD20 and FcεRIβ) are critical immune regulators, with CD20 important in B cell function and FcεRIβ in allergy responses

To study MS4A10's potential immune functions, researchers should:

  • Perform single-cell RNA-seq to identify specific immune cell populations expressing MS4A10

  • Assess changes in immune parameters following MS4A10 knockdown in relevant cell types

  • Investigate potential associations between MS4A10 polymorphisms and immune-related disorders

  • Examine MS4A10 expression changes during immune activation or differentiation

How can MS4A10 function be studied in the context of transmembrane protein biology?

As a protein with multiple transmembrane domains, studying MS4A10 requires specialized approaches:

  • Structural characterization:

    • Utilize cryo-electron microscopy to determine protein structure, particularly challenging for multi-pass transmembrane proteins

    • Employ NMR spectroscopy for dynamic structural information

    • Use molecular dynamics simulations to predict conformational changes

  • Membrane topology analysis:

    • Apply glycosylation site mapping to determine extracellular domains

    • Use protease protection assays to identify cytoplasmic regions

    • Implement FRET-based approaches to measure protein-protein interactions within the membrane

  • Functional domain mapping:

    • Generate truncation mutants to identify essential functional regions

    • Create chimeric proteins with other MS4A family members to determine domain-specific functions

    • Develop point mutations at conserved residues to identify critical amino acids

  • Trafficking and localization:

    • Track protein movement using fluorescently-tagged MS4A10 constructs

    • Analyze lipid raft association through detergent resistance and co-localization studies

    • Investigate endocytosis and recycling pathways with pulse-chase experiments

These approaches should be integrated with biological readouts relevant to MS4A10's cellular function to provide meaningful insights.

What are the challenges and solutions in generating specific antibodies against MS4A10?

Developing specific antibodies against multi-pass transmembrane proteins like MS4A10 presents several challenges:

ChallengeSolutionMethodology
Limited accessible epitopesTarget extracellular loops and N/C terminiUse bioinformatics tools to predict surface-exposed regions based on transmembrane topology
Cross-reactivity with other MS4A family membersDesign peptides from unique regionsPerform sequence alignment of all MS4A proteins to identify MS4A10-specific sequences
Conformational epitopesUse native protein as immunogenExpress full-length protein in mammalian cells for immunization
Low immunogenicityCouple to carrier proteinsUse KLH or BSA conjugation to enhance immune response
Validation specificityComprehensive testingValidate antibodies using MS4A10 knockout/knockdown controls

For optimal antibody development:

  • Generate multiple antibodies targeting different epitopes

  • Screen candidates against both denatured and native protein

  • Test for specificity using siRNA knockdown of MS4A10

  • Validate across multiple techniques (Western blot, immunofluorescence, flow cytometry)

  • Confirm specificity by testing against other MS4A family members

How can systems biology approaches enhance our understanding of MS4A10 function?

Systems biology offers powerful tools to contextualize MS4A10 within broader biological networks:

  • Integration of -omics data:

    • Combine transcriptomics, proteomics, and metabolomics data to identify MS4A10-associated pathways

    • Analyze the 942 functional associations reported for MS4A10 across 8 biological entity categories

    • Connect MS4A10 expression patterns with tissue-specific gene networks

  • Network analysis:

    • Construct protein-protein interaction networks centered on MS4A10

    • Identify hub proteins that may connect MS4A10 to broader signaling cascades

    • Apply graph theory to predict critical nodes in MS4A10-associated networks

  • Machine learning approaches:

    • Develop predictive models of MS4A10 function based on expression data

    • Use pattern recognition to identify conditions where MS4A10 is differentially regulated

    • Apply deep learning to integrate diverse data types

  • Multi-scale modeling:

    • Connect molecular-level MS4A10 function to cellular phenotypes

    • Model the effects of MS4A10 perturbation on tissue-level processes

    • Simulate the impact of therapeutic targeting of MS4A10 pathways

Systems approaches are particularly valuable given the complex tissue-specific expression patterns of MS4A10 and its numerous functional associations .

What are the optimal conditions for transfection and expression of MS4A10 constructs?

For successful transfection and expression of MS4A10 constructs:

  • Plasmid design considerations:

    • Include codon optimization for the host cell system

    • Consider adding epitope tags that don't interfere with transmembrane domains

    • Design constructs with strong promoters appropriate for the experimental system

  • Transfection optimization:

    • For transient expression, lipid-based transfection reagents like Lipofectamine are effective for most cell types

    • For difficult-to-transfect cells, electroporation may yield better results

    • Optimize DNA:transfection reagent ratios (typically starting with manufacturer recommendations)

    • For primary cells, consider viral delivery systems such as lentivirus or adenovirus

  • Expression verification:

    • Confirm expression at 48-72 hours post-transfection for optimal results

    • Use qPCR to verify transcript levels

    • Employ western blotting with appropriate antibodies to confirm protein expression

    • Consider fluorescent tags for visual confirmation of expression and localization

  • Stable cell line generation:

    • Select appropriate antibiotic resistance markers

    • For lentiviral systems, determine optimal viral titer measured in CFU/ml

    • Screen multiple clones to identify those with appropriate expression levels

    • Verify stable integration using genomic PCR

How should researchers design experiments to study MS4A10 polymorphisms and variants?

When investigating MS4A10 polymorphisms and variants:

  • Variant identification:

    • Consult genomic databases to identify known MS4A10 polymorphisms

    • Consider sequence polymorphisms documented in MS4A family genes

    • Look for common splice variants, as observed in other MS4A family members (MS4A4A, MS4A5, MS4A6A, and MS4A7)

    • Perform targeted sequencing in populations of interest

  • Functional characterization:

    • Express variant forms using appropriate expression systems

    • Compare expression levels, cellular localization, and stability

    • Assess impact on interaction partners through co-immunoprecipitation

    • Evaluate effects on downstream signaling pathways

  • Population studies:

    • Analyze variant frequency in different populations

    • Investigate associations with specific disease phenotypes

    • Perform case-control studies for conditions where MS4A family members show relevance

  • Structure-function relationships:

    • Model the structural impact of variants, particularly those affecting transmembrane domains

    • Focus on polymorphisms in functional domains or conserved regions

    • Consider the impact of variants on post-translational modifications

Integrating computational prediction with experimental validation provides the most robust approach to understanding the functional significance of MS4A10 variants.

What considerations are important when designing MS4A10 fusion proteins for imaging studies?

When creating MS4A10 fusion proteins for imaging applications:

  • Tag selection and placement:

    • Choose tags that minimize interference with protein folding and function

    • Consider small tags (e.g., FLAG, HA) for fixed cell imaging

    • Use fluorescent proteins (e.g., GFP, mCherry) for live-cell imaging

    • Avoid placing tags within transmembrane domains or at critical functional sites

    • Test both N- and C-terminal tagging strategies, as one may disrupt function less than the other

  • Expression level control:

    • Use inducible expression systems to prevent artifacts from overexpression

    • Titrate expression to physiologically relevant levels

    • Compare localization patterns at different expression levels

  • Validation approaches:

    • Confirm that tagged MS4A10 retains normal subcellular localization

    • Verify that protein function remains intact using appropriate assays

    • Compare results with endogenous protein localization when possible

  • Advanced imaging considerations:

    • For FRET studies, ensure appropriate donor-acceptor pairs

    • For super-resolution microscopy, select tags compatible with the technique

    • For pulse-chase experiments, use photoconvertible or photoactivatable fluorescent proteins

    • Consider split fluorescent protein approaches for protein-protein interaction studies

Careful design and thorough validation of fusion constructs are essential for generating reliable imaging data for transmembrane proteins like MS4A10.

What emerging technologies could advance our understanding of MS4A10 function?

Several cutting-edge technologies hold promise for elucidating MS4A10 biology:

  • CRISPR-based functional genomics:

    • Genome-wide CRISPR screens to identify synthetic lethal interactions with MS4A10

    • CRISPRa/CRISPRi approaches to modulate MS4A10 expression with temporal precision

    • Base editing to introduce specific point mutations without double-strand breaks

    • Prime editing for precise genomic modifications to study variant functions

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell populations with highest MS4A10 expression

    • Single-cell proteomics to correlate MS4A10 protein levels with cellular phenotypes

    • Spatial transcriptomics to map MS4A10 expression in tissue contexts

    • Multi-omics approaches combining genomic, transcriptomic, and proteomic data at single-cell resolution

  • Advanced structural biology:

    • Cryo-electron tomography to visualize MS4A10 in native membrane environments

    • AlphaFold2 and similar AI approaches to predict structural interactions

    • Mass spectrometry techniques for transmembrane protein characterization

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic conformational changes

  • Organoid and advanced cell culture models:

    • Tissue-specific organoid systems to study MS4A10 in physiologically relevant contexts

    • Microfluidic organ-on-chip models to investigate functional roles in complex tissues

    • Co-culture systems to examine cell-cell communication roles of MS4A10

How might targeting MS4A10 be relevant for therapeutic development?

While specific therapeutic applications for MS4A10 are not detailed in the provided search results, potential approaches can be considered:

  • Cancer immunotherapy:

    • Investigate if MS4A10, like other MS4A family members, influences immune infiltration in tumors

    • Explore whether MS4A10 modulation could enhance anti-tumor immune responses

    • Determine if MS4A10 expression correlates with response to existing immunotherapies

  • Targeted therapeutics:

    • Develop antibodies or small molecules that modulate MS4A10 function

    • Explore siRNA-based approaches for tissue-specific knockdown

    • Consider MS4A10 as a potential biomarker for patient stratification

  • Tissue-specific applications:

    • Focus on tissues with highest MS4A10 expression (based on expression databases)

    • Investigate potential roles in epithelial barriers or specialized tissue functions

    • Examine expression in disease contexts to identify therapeutic opportunities

  • Family-based approach:

    • Consider MS4A10 in the context of therapeutic strategies targeting the broader MS4A family

    • Investigate functional redundancy and potential compensatory mechanisms

    • Develop pan-MS4A targeting strategies for conditions where multiple family members are implicated

Any therapeutic development should be preceded by thorough validation of MS4A10's role in the targeted disease process and careful assessment of potential off-target effects.

What are the most significant knowledge gaps in MS4A10 research?

Current understanding of MS4A10 reveals several critical knowledge gaps that merit further investigation:

  • Tissue-specific functions:

    • Detailed characterization of MS4A10 expression across normal and pathological tissues

    • Identification of the physiological role of MS4A10 in tissues where it shows highest expression

    • Understanding the consequences of MS4A10 loss in knockout models

  • Molecular mechanisms:

    • Elucidation of signaling pathways directly regulated by MS4A10

    • Identification of binding partners and regulatory molecules

    • Characterization of post-translational modifications affecting MS4A10 function

  • Disease relevance:

    • Systematic evaluation of MS4A10 expression changes across different pathologies

    • Investigation of MS4A10 variants and their potential contribution to disease risk

    • Understanding the role of MS4A10 in immune-related disorders given the function of other MS4A family members

  • Evolutionary context:

    • Comparative analysis of MS4A10 across species to identify conserved functional domains

    • Understanding the evolutionary pressures that shaped the MS4A gene family expansion

    • Identification of species-specific adaptations in MS4A10 function

Addressing these knowledge gaps will require integrated approaches combining genomic, proteomic, biochemical, and cellular techniques in physiologically relevant experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.