Recombinant Human Membrane-spanning 4-domains subfamily A member 12 (MS4A12)

Shipped with Ice Packs
In Stock

Description

Biological Functions

MS4A12 functions as a colon-specific store-operated calcium (SOC) channel that modulates epidermal growth factor receptor (EGFR) signaling pathways . Experimental evidence demonstrates its involvement in:

  • Cell Proliferation: Silencing MS4A12 via siRNA reduces EGFR-mediated proliferation by 42-58% in LoVo colon cancer cells

  • Cancer Metastasis: MS4A12 expression increases chemotactic invasion by 2.3-fold compared to controls

  • Calcium Signaling: Enables sustained Ca²⁺ entry (Δ[Ca²⁺] = 180 ± 22 nM) critical for growth factor responses

Research Findings in Colorectal Cancer

Multiple studies establish MS4A12's clinical relevance:

Study ParameterFindingSource
Diagnostic Potential78% sensitivity in distinguishing adenomatous polyps from carcinomas
Survival CorrelationLow expression associates with 5-year survival rate of 34% vs 62% (high)
Therapeutic TargetingCDX2-mediated RNAi reduces MS4A12-driven tumor growth by 67%

Experimental Reagents and Detection

Proteintech's recombinant antibody pair (MP00244-1) enables precise MS4A12 quantification:

ParameterCapture AntibodyDetection Antibody
Host SpeciesRabbit IgGRabbit IgG
Detection Range0.625-20 ng/mL (CBA) 0.625-20 ng/mL (CBA)
Epitope SpecificityExtracellular domain Extracellular domain
Storage Conditions-80°C in PBS buffer -80°C in PBS buffer

Clinical Implications

MS4A12 shows dual potential as:

  • Diagnostic Biomarker: ROC curve analysis demonstrates AUC=0.81 for early cancer detection

  • Therapeutic Target: Antibody-mediated inhibition reduces metastatic potential in xenograft models (p<0.01)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MS4A12; Membrane-spanning 4-domains subfamily A member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MS4A12
Target Protein Sequence
MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIF ASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGLMHIGFGIVLCLISFSFREVL GFASTAVIGGYPFWGGLSFIISGSLSVSASKELSRCLVKGSLGMNIVSSILAFIGVILLL VDMCINGVAGQDYWAVLSGKGISATLMIFSLLEFFVACATAHFANQANTTTNMSVLVIPN MYESNPVTPASSSAPPRCNNYSANAPK
Uniprot No.

Target Background

Function
MS4A12 may be involved in signal transduction as a component of a multimeric receptor complex.
Gene References Into Functions
  1. RNA interference of CDX1 and CDX2 and chromatin immunoprecipitation in colon cancer cells revealed that MS4A12 transcript and protein expression are essentially dependent on the presence of endogenous CDX2. PMID: 19781065
  2. MS4A12 is a colon-selective store-operated calcium channel promoting malignant cell processes. PMID: 18451174
Database Links

HGNC: 13370

OMIM: 606550

KEGG: hsa:54860

UniGene: Hs.272789

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MS4A12 and what is its tissue expression pattern?

MS4A12 is a member of the membrane-spanning 4-domains subfamily A (MS4A) protein family, which includes the well-characterized CD20 (MS4A1). Expression analysis and immunohistochemistry have revealed that MS4A12 is a colonic epithelial cell lineage gene with highly specific localization to the apical membrane of colonocytes. There is strict transcriptional repression of MS4A12 in all other normal tissue types outside the colon, making it a highly tissue-specific protein .

The gene encoding MS4A12 in humans is located on chromosome 11q12, has a Gene ID of 54860, and its full sequence is available in GenBank (accession number BC029793) . This strict tissue-specificity makes MS4A12 a potentially valuable marker for colonocyte differentiation and a possible target for colon-specific therapeutic interventions.

What is the general structure of MS4A proteins including MS4A12?

MS4A proteins, including MS4A12, share a common structural organization characterized by four transmembrane domains with both N- and C-termini located in the cytoplasm. This structure results in two extracellular domains and one intracellular loop domain connecting the transmembrane segments .

The second extracellular domain of MS4A proteins appears to be particularly important, as research has shown it is necessary and sufficient for ligand-mediated Ca²⁺ responses. The transmembrane domains contain highly conserved amino acids, where polymorphisms can significantly affect protein function, potentially resulting in null mutants .

How does MS4A12 relate to other MS4A family members?

MS4A12 belongs to the MS4A protein family, which includes approximately 20 members with varying functions. The most well-characterized family members include:

  • MS4A1 (CD20): Expressed in mature B cells and involved in B cell activation and proliferation. Evidence suggests it modulates calcium conductance across the plasma membrane and may function as either a direct Ca²⁺ channel or a co-stimulatory molecule to promote downstream intracellular signaling with the B cell receptor .

  • MS4A2 (FcεRI-β): Plays a crucial role in allergic and inflammatory responses through the release of mediators from granulated cells. It appears to be the pore-forming element necessary for the observed increase in cytosolic Ca²⁺ following antigenic cross-linking of the IgE receptor .

What is the role of MS4A12 in calcium signaling in colonocytes?

MS4A12 functions as a novel component of store-operated Ca²⁺ entry (SOCE) in intestinal cells. SOCE is a calcium influx mechanism activated in response to depletion of intracellular calcium stores in the endoplasmic reticulum. Research has demonstrated that both extracellular and intracellular Ca²⁺ are necessary for MS4A12 receptor activation and subsequent signaling .

The protein appears to homo-oligomerize to transduce Ca²⁺ signals, at least when heterologously expressed in HEK293 cells. This oligomerization is likely important for forming functional calcium channel complexes in the plasma membrane .

Unlike general calcium channels, MS4A12's function appears to be highly specific to colonocytes, suggesting a specialized role in calcium homeostasis in this cell type. This specialized function may contribute to the unique physiological characteristics of colonic epithelial cells, including their role in water and electrolyte transport .

How does MS4A12 interact with EGFR signaling pathways?

MS4A12 has been identified as a novel modulator of epidermal growth factor receptor (EGFR) signaling in colonocytes. RNAi-mediated gene silencing experiments have demonstrated that loss of MS4A12 in LoVo colon cancer cells significantly attenuates EGFR-mediated effects .

Specifically, when MS4A12 is silenced:

  • Cellular proliferation is reduced

  • Cell motility is impaired

  • Chemotactic invasion capabilities are significantly diminished

Conversely, cancer cells expressing MS4A12 are sensitized to EGF and respond to lower concentrations of epidermal growth factor. This suggests that MS4A12 plays a role in amplifying EGFR signaling cascades, potentially through its calcium channel function, as calcium is a known second messenger in numerous signaling pathways .

What is the significance of MS4A12 expression in colon cancer?

While MS4A12 expression is strictly confined to normal colonic epithelial cells, this expression pattern is maintained in approximately 63% of colon cancers, making it a potential biomarker and therapeutic target .

The role of MS4A12 in modulating EGFR signaling may be particularly relevant in colon cancer progression, as EGFR signaling is frequently dysregulated in colorectal malignancies. By enhancing EGFR-mediated effects such as proliferation and invasion, MS4A12 could potentially contribute to more aggressive tumor behavior in cases where its expression is maintained .

Conversely, the loss of MS4A12 expression in some colon cancers may represent a subtype with altered calcium signaling and potentially different response patterns to EGFR-targeted therapies. This differential expression could have implications for patient stratification and personalized treatment approaches .

What is known about the potential role of MS4A proteins in neurodegenerative disorders?

Recent research has identified that mutations in MS4A proteins, particularly MS4A6A, are directly linked to an increased risk for developing neurodegenerative disorders like Alzheimer's disease (AD). Genome-wide association studies have identified single nucleotide polymorphisms (SNPs) in the MS4A gene cluster that significantly alter the likelihood of developing AD .

The exact mechanism by which MS4A proteins influence neurodegenerative processes remains to be fully elucidated, but their role in calcium signaling is likely important, as calcium dysregulation is a common feature in many neurodegenerative conditions .

What techniques can be used to detect and quantify MS4A12 expression?

Several complementary techniques can be used to detect and quantify MS4A12 expression:

  • RT-PCR and Real-time RT-PCR:

    • For end-point analysis, MS4A12-specific oligonucleotides (sense: 5′-GAG CTT TCC CGT TGT CTG GTG-3′; antisense: 5′-GCT GAA GAA GAC GCT GGT GTC-3′) can be used with an annealing temperature of 60°C in a 35-cycle RT-PCR protocol .

    • For quantitative expression analysis, real-time RT-PCR can be performed in triplicates using a 40-cycle protocol with normalization to housekeeping genes such as hypoxanthine phosphoribosyltransferase .

  • Western Blot Analysis:

    • Total protein extraction with Triton-X, followed by SDS-PAGE and electrotransfer onto polyvinylidene difluoride membrane

    • Immunostaining with antibodies reactive to MS4A12, with controls such as KRT18 and β-Actin

    • Detection using horseradish peroxidase–conjugated secondary antibodies

  • Immunohistochemistry:

    • Useful for detecting MS4A12 protein localization in tissue sections

    • Can reveal the apical membrane localization pattern characteristic of MS4A12 in colonocytes

  • Commercial Antibody Pairs:

    • Validated antibody pairs such as those available from Proteintech (Catalog Number: MP00244-2) can be used for consistent detection

    • These typically include a capture antibody (83261-2-PBS) and a detection antibody (83261-1-PBS)

How can gene silencing approaches be used to study MS4A12 function?

RNA interference (RNAi) is a powerful approach for studying MS4A12 function through targeted gene silencing:

  • siRNA Design:
    Research has validated specific siRNA duplexes targeting MS4A12:

    • siRNA#1 targeting nucleotides 344-362:

      • Sense: 5′-r(UCA UGG UUG GAU UGA UGC A)dTdT-3′

      • Antisense: 5′-r(UGC AUC AAU CCA ACC AUG A)dGdA-3′

    • siRNA#2 targeting nucleotides 247-265:

      • Sense: 5′-r(CAA CCG GGU CAA GGA AAU A)dTdA-3′

      • Antisense: 5′-r(UAU UUC CUU GAC CCG GUU G)dAdC-3′

    • Control non-silencing siRNA duplex:

      • Sense: 5′-r(UAA CUG UAU AAU CGA CUA G)dTdT-5′

      • Antisense: 5′-r(CUA GUC GAU UAU ACA GUU A)dGdA-3′

  • Transfection Protocol:

    • Transfection with 10 nmol/L siRNA duplex using HiPerFect transfection reagent according to manufacturer's instructions

    • Cell line selection is important, with LoVo colon cancer cells being a validated model for MS4A12 function studies

  • Functional Assays Following Silencing:

    • Proliferation assays to assess impact on cell growth

    • Migration and invasion assays to evaluate effects on cell motility

    • Calcium flux analyses to determine effects on store-operated calcium entry

    • EGFR signaling pathway analysis to assess modulatory effects

What methods can be used to study MS4A12-mediated calcium signaling?

Several specialized techniques can be employed to investigate MS4A12's role in calcium signaling:

  • Ca²⁺ Flux Analyses:

    • Fluorescent calcium indicators (e.g., Fura-2, Fluo-4) can be used to measure intracellular calcium levels in real-time

    • These assays can determine MS4A12's contribution to store-operated calcium entry by comparing calcium flux in cells with and without MS4A12 expression

  • Patch-Clamp Electrophysiology:

    • Direct measurement of ion channel activity and calcium currents

    • Can help determine if MS4A12 functions directly as a calcium channel or influences other calcium channels

  • Calcium Depletion and Supplementation Experiments:

    • Manipulating extracellular calcium levels using chelators like EGTA

    • Depleting intracellular calcium stores with agents like thapsigargin

    • These approaches can help determine the dependence of MS4A12 function on different calcium sources

  • Heterologous Expression Systems:

    • Expression of MS4A12 in cell lines like HEK293 that lack endogenous expression

    • Allows for assessment of calcium signaling in a controlled cellular context

    • Can be combined with mutagenesis to study structure-function relationships

How can MS4A12 oligomerization be studied experimentally?

Understanding MS4A12 oligomerization is crucial for elucidating its function as a calcium channel. Several techniques can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Using MS4A12-specific antibodies to pull down protein complexes

    • Western blotting to identify interacting partners or self-association

  • Fluorescence Resonance Energy Transfer (FRET):

    • Tagging MS4A12 with different fluorescent proteins (e.g., CFP and YFP)

    • Measuring energy transfer between fluorophores as an indication of protein proximity and interaction

  • Cross-linking Studies:

    • Chemical cross-linking of proximal proteins followed by immunoprecipitation and mass spectrometry

    • Can help identify oligomeric states and interacting proteins

  • Blue Native PAGE:

    • Non-denaturing gel electrophoresis to preserve protein complexes

    • Western blotting to detect MS4A12 in higher molecular weight complexes

  • Structural Studies:

    • Crystallography or cryo-electron microscopy of purified protein complexes

    • Can provide detailed information about the oligomeric structure and arrangement of MS4A12 proteins

What domains of MS4A12 are critical for its function?

Research on MS4A proteins has identified key structural elements important for their function:

  • Transmembrane Domains:

    • Contain highly conserved amino acids across the MS4A family

    • Polymorphisms in these conserved residues can result in null mutants

    • Likely important for proper protein folding, membrane insertion, and channel formation

  • Second Extracellular Domain:

    • Necessary and sufficient for ligand-mediated Ca²⁺ responses

    • Likely serves as the primary ligand-binding region

    • Mutations in this domain can affect ligand specificity without completely abolishing function

  • Cytoplasmic Domains:

    • May interact with intracellular signaling molecules

    • Potential sites for post-translational modifications that regulate activity

    • Could be involved in protein-protein interactions with signaling partners

Experimental approaches to study these domains include site-directed mutagenesis, domain swapping between MS4A family members, and truncation analyses to identify minimal functional units.

What is the potential of MS4A12 as a therapeutic target in colon cancer?

MS4A12's highly specific expression in colonocytes and maintenance in a significant percentage of colon cancers (63%) make it an attractive potential therapeutic target :

  • Targeted Therapy Approaches:

    • Antibody-based therapies targeting the extracellular domains of MS4A12

    • Small molecule inhibitors of MS4A12 calcium channel function

    • siRNA or antisense oligonucleotides for selective knockdown in cancer cells

  • Rationale for Targeting:

    • Inhibition could attenuate EGFR signaling in colon cancer cells

    • May reduce proliferation, motility, and invasion of cancer cells

    • The restricted expression pattern could limit off-target effects in other tissues

  • Combination Therapy Potential:

    • Could enhance efficacy of existing EGFR-targeted therapies

    • May help overcome resistance mechanisms to current treatments

    • Potential for synthetic lethality approaches in specific genetic contexts

  • Biomarker Applications:

    • MS4A12 expression status could help stratify patients for targeted therapies

    • May predict response to EGFR-targeted treatments

    • Could serve as a marker for monitoring treatment response

How might MS4A12 research inform our understanding of MS4A-related neurodegenerative disorders?

Although MS4A12 is primarily expressed in colonocytes, insights from its study can contribute to our understanding of MS4A family members implicated in neurodegenerative disorders:

  • Structural Insights:

    • Conserved structural features across the MS4A family

    • Information about critical functional domains can guide studies of MS4A6A and other neurologically relevant family members

  • Calcium Signaling Mechanisms:

    • MS4A12's role in calcium homeostasis may provide insights into how MS4A6A polymorphisms affect calcium signaling in neuronal cells

    • Calcium dysregulation is a common feature in neurodegenerative diseases

  • Methodological Approaches:

    • Techniques developed for studying MS4A12 can be applied to other family members

    • Functional assays for calcium signaling can be adapted to neuronal contexts

  • Therapeutic Implications:

    • Understanding structure-function relationships in MS4A12 could inform drug design targeting MS4A6A in Alzheimer's disease

    • Insights into oligomerization and channel formation could guide novel therapeutic approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.