Recombinant Human Membrane-spanning 4-domains subfamily A member 5 (MS4A5)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

MS4A5 (Membrane-Spanning 4-Domains Subfamily A Member 5), also known as CD20L2 or TETM4, is a tetraspanin protein encoded by the MS4A5 gene located at 11q12.2 . It belongs to the MS4A superfamily, which includes 18 human members involved in ion channel activity, immune signaling, and chaperone functions . Recombinant MS4A5 is produced to study its structural and functional roles in vitro, particularly in signal transduction and disease mechanisms .

Functional Insights

While direct functional data for recombinant MS4A5 remain limited, studies on related MS4A proteins provide context:

  • Ion Channel Activity: MS4A1 (CD20) regulates calcium flux in B cells .

  • Chaperone Roles: MS4A4A interacts with Dectin-1 to activate SYK signaling in macrophages .

  • Disease Links:

    • Alzheimer’s Disease (AD): MS4A4A and MS4A6A variants modulate soluble TREM2 levels, influencing AD risk .

    • Cancer: MS4A members regulate immune cell activation and tumor progression .

Recombinant MS4A5’s activity is inferred but unvalidated, as its conformational folding in wheat germ systems may preserve native functionality .

Research Applications

Recombinant MS4A5 is primarily used in:

  • Immunoassays: ELISA, Western blot, and affinity purification .

  • Protein-Protein Interaction Studies: Potential roles in multimeric receptor complexes .

  • Disease Modeling: Insights into MS4A family contributions to AD and autoimmune disorders .

Table 2: Key Research Findings Involving MS4A Proteins

ProteinFunctionDisease AssociationReference
MS4A4AEnhances TREM2 signalingAlzheimer’s disease
MS4A6DRegulates macrophage inflammationAutoimmune disorders
MS4A1Calcium channel in B cellsLymphomas

Production Challenges and Solutions

  • Expression Efficiency: ~50% of recombinant proteins fail to express due to translation initiation inefficiencies .

  • Optimization Strategies: Synonymous codon substitutions in mRNA initiation regions improve yield .

  • System Choice: Wheat germ preserves folding, while ALiCE® enables difficult-to-express proteins .

Limitations and Future Directions

  • Unvalidated Activity: No direct functional assays confirm MS4A5’s biological role .

  • Therapeutic Potential: MS4A family members are emerging drug targets for AD and cancer .

  • Technical Gaps: Improved expression systems and structural studies (e.g., cryo-EM) are needed.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MS4A5; CD20L2; TETM4; Membrane-spanning 4-domains subfamily A member 5; CD20 antigen-like 2; Testis-expressed transmembrane protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MS4A5
Target Protein Sequence
MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIM TFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIM NFLSALGAIAGIILLTFGFILDQNYICGYSHQNSQCKAVTVLFLGILITLMTFSIIELFI SLPFSILGCHSEDCDCEQCC
Uniprot No.

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Database Links

HGNC: 13374

OMIM: 606499

KEGG: hsa:64232

STRING: 9606.ENSP00000300190

UniGene: Hs.178066

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high level in the testis. Detected also in the pancreas, heart and in the brain.

Q&A

What is the basic structure of human MS4A5 protein?

Human MS4A5 belongs to the MS4A superfamily of four-transmembrane proteins. The protein consists of 200 amino acids with four membrane-spanning domains, which is characteristic of all MS4A family members. The protein sequence includes multiple hydrophobic regions that facilitate membrane integration with both N- and C-termini facing the cytoplasm. The full amino acid sequence includes: "MDSSTAHSPV FLVFPPEITA SEYESTELSA TTFSTQSPLQ KLFARKMKIL GTIQILFGIM TFSFGVIFLF TLLKPYPRFP FIFLSGYPFW GSVLFINSGA FLIAVKRKTT ETLIILSRIM NFLSALGAIA GIILLTFGFI LDQNYICGYS HQNSQCKAVT VLFLGILITL MTFSIIELFI SLPFSILGCH SEDCDCEQCC" . When designing experiments with recombinant MS4A5, researchers should consider this transmembrane topology for optimal protein expression and functional analysis.

Where is MS4A5 primarily expressed in human tissues?

MS4A5 expression is predominantly detected in testes and CD33+ myeloid cells . Unlike other MS4A family members that show broader expression across multiple immune cell types, MS4A5's relatively restricted expression pattern suggests tissue-specific functions. When designing tissue-specific research, investigators should consider using appropriate positive controls (testicular or myeloid cell lysates) for validation of antibody specificity, especially when characterizing novel anti-MS4A5 antibodies for immunohistochemistry or flow cytometry applications.

What expression systems are available for producing recombinant human MS4A5?

Recombinant human MS4A5 can be produced using several expression systems, each with distinct advantages for different experimental applications:

  • Wheat germ cell-free expression system: Particularly useful for producing MS4A5 protein with GST tags. This system provides good yield for membrane proteins and avoids potential toxicity issues associated with overexpression in cellular systems .

  • HEK-293 cells: Suitable for producing MS4A5 with His tags, offering mammalian post-translational modifications that may be critical for functional studies .

  • Cell-free protein synthesis (CFPS): Can generate MS4A5 with Strep tags and is advantageous for rapid production without cell culture requirements .

When selecting an expression system, researchers should consider downstream applications, required protein modifications, and purification strategies.

What purification strategies work best for recombinant MS4A5?

For GST-tagged MS4A5 expressed in wheat germ systems, glutathione affinity chromatography is effective, with elution in buffers containing 50 mM Tris-HCl and 10 mM reduced glutathione at pH 8.0 . For His-tagged constructs, immobilized metal affinity chromatography (IMAC) is recommended. Quality control should include SDS-PAGE, Western blotting, and analytical size exclusion chromatography to verify protein purity (aim for >90% for His-tagged and >70-80% for Strep-tagged variants) . To preserve protein functionality, researchers should avoid repeated freeze-thaw cycles by preparing small aliquots for storage at -80°C.

What are recommended applications for recombinant MS4A5 protein?

Recombinant MS4A5 can be utilized in multiple experimental approaches:

  • ELISA: For developing quantitative assays to measure MS4A5 levels in biological samples.

  • Western Blotting: For validation of antibody specificity and detection of native MS4A5 in tissue extracts.

  • Affinity Purification: For identifying protein-protein interactions and MS4A5 binding partners.

  • Antibody Arrays: For high-throughput screening of MS4A5 interactions .

For each application, researchers should optimize protein concentration, buffer conditions, and detection methods through systematic titration experiments.

What genomic approaches are used to study MS4A5 variants?

Next-generation sequencing (NGS) is the primary method for comprehensive mutation analysis of MS4A5 and other MS4A gene cluster members . When designing genetic studies:

  • Consider targeting the entire MS4A locus (Chr11q12, specifically Chr11:59611961–60103563/hg18) to capture all MS4A family genes in context.

  • Include analysis of both coding variants (missense, nonsense, frameshift) and potential regulatory regions that might affect expression.

  • Implement appropriate bioinformatic pipelines for variant calling, including tools that calculate Fisher's exact test p-values and address multiple testing through false discovery rate (FDR) calculations .

  • Validate findings with orthogonal methods such as Sanger sequencing for novel or rare variants.

How does MS4A5 compare functionally to other MS4A family members?

While MS4A family members share structural similarities (four-transmembrane domains), they exhibit distinct expression patterns and functional profiles:

  • MS4A1 (CD20): Expressed on B cells, forms complexes with MHC molecules and B cell receptors to promote B cell activation .

  • MS4A2: Associates with FcεRIα and FcεRIγ on mast cells, functioning in allergic responses .

  • MS4A4A: Expressed on macrophages and mast cells, interacts with Dectin-1 and regulates KIT trafficking .

  • MS4A5: Expressed in testes and CD33+ myeloid cells, with functions in cell surface receptor signaling .

Unlike MS4A4A, which has been shown to regulate the cell cycle and G1-S phase transition , specific molecular mechanisms for MS4A5 remain less characterized. Researchers should consider comparative studies between MS4A family members to elucidate both shared and unique functional properties.

What are effective approaches for studying MS4A5 protein interactions?

To investigate MS4A5 protein interactions, researchers should consider:

  • Co-immunoprecipitation (Co-IP) using recombinant tagged MS4A5 as bait to identify binding partners in relevant cell types (testicular or myeloid cells).

  • Proximity labeling methods such as BioID or APEX2, which can capture transient or weak interactions within the native membrane environment.

  • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) assays to examine dynamic interactions in living cells.

  • Crosslinking mass spectrometry to identify specific interaction domains and binding interfaces.

Given that some MS4A proteins function as molecular chaperones interacting with pattern recognition receptors and immunoglobulin receptors , researchers should investigate whether MS4A5 forms similar complexes in its native cellular context.

How can researchers effectively study MS4A5's role in calcium signaling?

To investigate MS4A5's potential function as an ion channel regulating calcium transport:

  • Establish cell lines with controlled MS4A5 expression (overexpression, knockdown, or knockout) using lentiviral vectors or CRISPR-Cas9 technology.

  • Employ calcium imaging techniques with fluorescent indicators (Fluo-4, Fura-2) to measure real-time calcium flux in response to various stimuli.

  • Perform patch-clamp electrophysiology to directly measure ion channel properties of MS4A5.

  • Use site-directed mutagenesis to identify critical residues for ion channel function, particularly in the transmembrane domains.

Other MS4A family members (like MS4A12) have been confirmed as components of store-operated calcium entry , providing a methodological framework for similar studies with MS4A5.

What gene expression analysis approaches are recommended for MS4A5 research?

When studying MS4A5 gene expression:

  • Quantitative RT-PCR with validated primers: Forward primer 5′-TTC TGA TTG CCT TGA TGA GC-3′ and reverse primer 5′-TAA GGA TAC ATC ACT GAC CC-3′ have been used successfully for MS4A family studies .

  • RNA-seq for comprehensive transcriptomic profiling, which can reveal co-expression patterns with other genes.

  • Single-cell RNA sequencing to identify specific cell populations expressing MS4A5, particularly within heterogeneous tissues.

  • Chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors regulating MS4A5 expression.

Researchers should normalize expression data to appropriate reference genes and validate findings across multiple experimental models.

How might MS4A5 function in myeloid cell biology?

Given MS4A5's expression in CD33+ myeloid cells , researchers should investigate:

  • The impact of MS4A5 on myeloid cell development, differentiation, and function using lineage-specific knockdown/knockout models.

  • Potential roles in phagocytosis, antigen presentation, or cytokine production through functional assays comparing wild-type and MS4A5-deficient myeloid cells.

  • MS4A5's involvement in calcium-dependent signaling pathways that regulate myeloid cell activation or migration.

  • Changes in MS4A5 expression during myeloid cell activation or in response to inflammatory stimuli.

Unlike MS4A4A, which is induced by M2-like stimuli in macrophages , the specific regulation and function of MS4A5 in myeloid cells remains to be fully elucidated.

What are potential approaches for investigating MS4A5's function in testicular biology?

To explore MS4A5's role in testes, where it shows significant expression:

  • Utilize immunohistochemistry to determine precise cellular localization within testicular tissue (Sertoli cells, Leydig cells, or developing germ cells).

  • Develop conditional knockout models to assess impacts on spermatogenesis, testicular development, or male fertility.

  • Investigate potential roles in hormone-responsive signaling pathways through hormone stimulation experiments in relevant cell models.

  • Examine MS4A5 expression changes during different stages of spermatogenesis using stage-specific markers and cell isolation techniques.

The testis-specific expression pattern suggests a specialized function that merits targeted investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.