Recombinant Human Membrane-spanning 4-domains subfamily A member 7 (MS4A7)

Shipped with Ice Packs
In Stock

Description

Cancer Biology

  • Lung Adenocarcinoma: Low MS4A7 expression correlates with poor prognosis and reduced immune infiltration (e.g., macrophages, dendritic cells). RT-qPCR validated downregulation in 8/9 patient samples .

  • Glioblastoma (GBM): The short isoform (MS4A7-s) promotes M2 macrophage polarization via PI3K/AKT/GSK3β signaling, accelerating tumor progression. Overexpression in GBM patients predicts shorter survival .

Immune Regulation

  • Microglia Function: MS4A7 is enriched in brain microglia and linked to Alzheimer’s disease pathways .

  • Monocytic Lineage: Associated with maturation and signal transduction in monocytes .

Table: MS4A7 in Disease Mechanisms

DiseaseExpression PatternFunctional RoleStudy TypeSource
Lung AdenocarcinomaDownregulatedImmune cell recruitment deficitTCGA analysis, RT-qPCR
GlioblastomaIsoform MS4A7-s upregulatedDrives M2 macrophage polarizationscRNA-seq, in vivo models
Alzheimer’s DiseaseGenetically linkedMicroglia activation pathwayGenetic association

Technical Considerations

  • Validation: Coomassie staining and microplate BCA assays confirm purity .

  • Antibodies: MS4A7 (E3E1A) Rabbit mAb (#80817) validated for human samples .

  • Orthologs: Mouse Ms4a7 (UniProt: Q9D2Z8) shares 75% sequence homology .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on your location and purchase method. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MS4A7; 4SPAN2; CD20L4; CFFM4; Membrane-spanning 4-domains subfamily A member 7; CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MS4A7
Target Protein Sequence
MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Uniprot No.

Target Background

Function
MS4A7 (Membrane-spanning 4-domains subfamily A member 7) may play a role in signal transduction as a component of a multimeric receptor complex.
Database Links

HGNC: 13378

OMIM: 606502

KEGG: hsa:58475

STRING: 9606.ENSP00000300184

UniGene: Hs.530735

Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous expression in normal tissues. Expression is more elevated in adult liver, lung, spleen, and heart than in their fetal counterparts, and is higher in normal tissues than in the cancerous tissue or cell lines. Low levels of expression were detect

Q&A

What is MS4A7 and what are its key structural characteristics?

MS4A7 (Membrane-spanning 4-domains subfamily A member 7) belongs to the MS4A gene family, which is characterized by common structural features and similar intron/exon splice boundaries. The gene is also known by several synonyms including 4SPAN2, CD20L4, CFFM4, and MS4A8 .

The protein contains four membrane-spanning domains, as indicated by its family name. It belongs to the transmembrane protein families and is considered part of the "druggable genome," suggesting its potential as a therapeutic target . The structure of MS4A7 facilitates its function in signal transduction pathways, particularly in immune cells.

Methodologically, researchers typically use computational tools like TMHMM or Phobius to predict transmembrane domains, and experimental techniques such as circular dichroism and X-ray crystallography to further characterize the structural properties of MS4A7.

What is the expression pattern of MS4A7 in normal human tissues?

MS4A7 exhibits tissue-specific expression patterns that vary between developmental stages and tissue types. MS4A7 expression is more elevated in adult liver, lung, spleen, and heart compared to their fetal counterparts . This developmental regulation suggests a role in mature tissue function rather than embryonic development.

In the hematopoietic system, MS4A7 is primarily expressed in B cells and monocytes . Outside the hematopoietic system, MS4A7 is present in non-hematopoietic cell types found in the colon, thymus, lung, and other organs .

To study MS4A7 expression patterns, researchers commonly employ:

  • RT-qPCR for quantitative mRNA expression analysis

  • Immunohistochemistry for tissue-specific protein localization

  • RNA sequencing for comprehensive transcriptomic profiling

  • Single-cell RNA sequencing to identify cell-type specific expression

How does MS4A7 expression differ between normal and cancerous tissues?

MS4A7 expression is generally higher in normal tissues than in cancerous tissues or cell lines . In lung adenocarcinoma specifically, MS4A7 expression is significantly downregulated compared to normal lung tissue . This pattern has been consistently observed across multiple studies using different methodologies.

In a comprehensive study analyzing the TCGA database, researchers found that MS4A7, along with several other MS4A family members (MS4A2/3/4A/6A/6E/8/10/14/15), showed reduced expression in lung adenocarcinoma tissues compared to normal tissues .

This finding has been validated through RT-qPCR experiments. In one study, MS4A7 expression was dramatically reduced in eight out of nine pairs of lung adenocarcinoma tissues compared to adjacent normal tissues, with no significant variation in the remaining pair .

Tissue TypeMS4A7 Expression LevelMethodologyReference
Normal LungHigherTCGA database analysis
Lung AdenocarcinomaLowerTCGA database analysis
Normal LungHigherRT-qPCR validation
Lung AdenocarcinomaLowerRT-qPCR validation

What is the prognostic significance of MS4A7 expression in cancer?

To investigate the prognostic value of MS4A7, researchers typically:

  • Perform survival analysis using Kaplan-Meier curves stratified by MS4A7 expression levels

  • Calculate hazard ratios with 95% confidence intervals

  • Use multivariate Cox regression analysis to adjust for confounding variables

  • Validate findings across independent cohorts

The mixed prognostic significance of MS4A7 across different cancer types highlights the need for cancer-specific investigation when considering MS4A7 as a biomarker.

How does MS4A7 relate to immune cell infiltration in tumor microenvironments?

MS4A7 expression shows strong correlations with immune cell infiltration in tumor microenvironments, particularly in lung adenocarcinoma. Immune infiltration analysis has revealed a significant correlation between MS4A7 expression and various immune cell populations, especially macrophages and dendritic cells .

The MS4A family as a whole is involved in immune-related pathways, and their expression is significantly correlated with the infiltration of multiple immune cell types, including B cells, CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and dendritic cells .

Methodologically, researchers investigate these relationships through:

  • Computational deconvolution of bulk RNA-seq data using tools like CIBERSORT or xCell

  • Correlation analysis between MS4A7 expression and immune cell marker genes

  • Multiplex immunohistochemistry to visualize co-localization of MS4A7 and immune cells

  • Flow cytometry analysis of dissociated tumor samples

These findings suggest that MS4A7 may play an important role in modulating the immune response within the tumor microenvironment, potentially affecting cancer progression and response to immunotherapy.

What experimental approaches are recommended for studying MS4A7 function in different cell types?

To study MS4A7 function in different cell types, researchers should consider a multi-faceted approach:

Genetic Manipulation Techniques:

  • CRISPR-Cas9-mediated gene knockout or knockin

  • shRNA or siRNA-mediated gene silencing

  • Overexpression studies using vectors like pCMV6-AC-GFP, which has been used for MS4A7 expression

  • Inducible expression systems for temporal control

Protein Interaction Studies:

  • Co-immunoprecipitation to identify binding partners

  • Proximity labeling techniques (BioID, APEX)

  • Fluorescence resonance energy transfer (FRET) for studying dynamic interactions

  • Lipid raft isolation to study membrane compartmentalization

Functional Assays:

  • Signal transduction pathway analysis using phosphorylation-specific antibodies

  • Calcium flux assays, given the role of MS4A family in calcium signaling

  • Migration and adhesion assays for immune cells

  • Phagocytosis assays for monocytes/macrophages

In Vivo Studies:

  • Conditional knockout mouse models

  • Humanized mouse models for studying human MS4A7 in vivo

  • Orthotopic xenograft models for cancer studies

When working with recombinant MS4A7 proteins, GFP-tagged constructs can be particularly useful for localization studies and tracking protein dynamics in living cells .

How does MS4A7 contribute to signal transduction pathways?

MS4A7 is believed to be a component of a receptor complex involved in signal transduction , though the specific pathways are still being elucidated. As a member of the MS4A family, which shares structural similarities with CD20, MS4A7 likely participates in transmembrane signaling events that affect cellular function.

The association of MS4A7 with mature cellular function in the monocytic lineage suggests its involvement in signaling pathways relevant to monocyte/macrophage function, potentially including:

  • Toll-like receptor signaling

  • Cytokine receptor signaling

  • Calcium signaling pathways

  • Phagocytosis-associated signaling

Gene Ontology (GO) and KEGG pathway enrichment analyses of MS4A family genes have revealed their involvement in immune-related pathways . To investigate MS4A7's specific role in these pathways, researchers can:

  • Use phosphoproteomics to identify downstream targets affected by MS4A7 manipulation

  • Employ reporter gene assays to monitor pathway activation

  • Analyze calcium flux using fluorescent indicators

  • Perform RNA-seq after MS4A7 perturbation to identify affected gene networks

What is the relationship between MS4A7 and other members of the MS4A gene family in pathological conditions?

The MS4A gene family members often show coordinated expression patterns in pathological conditions. In lung adenocarcinoma, multiple MS4A family genes (MS4A2/3/4A/6A/6E/7/8/10/14/15) are downregulated compared to normal tissues . This suggests common regulatory mechanisms or functional relationships among family members.

Of particular interest is the relationship between MS4A7 and other MS4A genes that have been implicated in Alzheimer's disease pathology. Some MS4A genes (particularly MS4A4A and MS4A6A) are associated with soluble TREM2 levels, which is a key modulator of neuroinflammation . While the search results don't directly address MS4A7's role in this context, the shared family characteristics suggest potential functional overlap.

Research methods to explore these relationships include:

  • Co-expression network analysis

  • Chromosome conformation capture techniques to identify shared regulatory elements

  • Comparative promoter analysis

  • Simultaneous knockdown/overexpression experiments

What are the optimal conditions for working with recombinant human MS4A7 protein?

When working with recombinant human MS4A7 protein, researchers should consider the following optimal conditions:

Storage and Stability:

  • Store at -20°C as recommended for commercially available constructs

  • Avoid repeated freeze-thaw cycles by preparing small aliquots

  • Use stabilizing buffers containing glycerol or protein carriers for long-term storage

Expression Systems:

  • Mammalian expression systems (HEK293, CHO cells) are typically preferred for proper folding and post-translational modifications

  • The pCMV6-AC-GFP vector system has been successfully used for MS4A7 expression

  • Consider inducible expression systems for proteins that might affect cell viability

Purification Considerations:

  • As a transmembrane protein, MS4A7 requires detergent-based extraction methods

  • Use mild detergents (DDM, CHAPS) to maintain native conformation

  • Consider nanodiscs or amphipols for maintaining stability in solution

Functional Assays:

  • Perform activity assays at physiological pH (7.2-7.4)

  • Include appropriate cofactors based on predicted function

  • Consider the membrane environment when designing binding or activity assays

How can researchers effectively study MS4A7 in primary tissue samples?

Studying MS4A7 in primary tissue samples presents unique challenges due to tissue heterogeneity and potential degradation. Effective approaches include:

Tissue Preservation and Processing:

  • Flash freezing in liquid nitrogen for RNA/protein extraction

  • Formalin fixation and paraffin embedding (FFPE) for immunohistochemistry

  • Tissue preservation solutions for maintaining viability of dissociated cells

  • Single-cell suspension preparation for flow cytometry or single-cell sequencing

Expression Analysis:

  • RT-qPCR for targeted expression quantification, as demonstrated in studies of MS4A7 in lung adenocarcinoma

  • RNA in situ hybridization for spatial resolution of expression

  • Single-cell RNA sequencing for cell type-specific expression profiles

  • Digital spatial profiling for combining spatial and expression data

Protein Detection:

  • Immunohistochemistry with validated antibodies

  • Multiplexed immunofluorescence for co-localization studies

  • Mass cytometry (CyTOF) for high-dimensional protein profiling

  • Imaging mass spectrometry for spatial proteomic analysis

Functional Studies:

  • Ex vivo culture systems to maintain tissue architecture

  • Precision-cut tissue slices for short-term functional studies

  • Patient-derived organoids for long-term studies

  • Primary cell isolation and short-term culture

What are the most reliable methods for quantifying MS4A7 expression changes in experimental settings?

To reliably quantify MS4A7 expression changes in experimental settings, researchers should consider multiple complementary approaches:

RNA-level Quantification:

  • RT-qPCR with properly validated primers and reference genes

    • This method was successfully employed in studies comparing MS4A7 expression between lung adenocarcinoma and normal tissues

  • Droplet digital PCR for absolute quantification

  • RNA-seq for genome-wide expression analysis

  • NanoString for direct counting without amplification

Protein-level Quantification:

  • Western blot with validated antibodies and appropriate loading controls

  • ELISA for quantitative analysis in cell lysates or supernatants

  • Flow cytometry for cell-by-cell analysis of expression levels

  • Mass spectrometry-based proteomics for unbiased quantification

Data Analysis Considerations:

  • Use multiple reference genes for RT-qPCR normalization

  • Apply appropriate statistical tests based on data distribution

  • Consider batch effects in large-scale experiments

  • Validate findings using multiple technical and biological replicates

When working with recombinant GFP-tagged MS4A7, researchers can also quantify expression through:

  • Fluorescence intensity measurements

  • Live-cell imaging with quantitative analysis

  • Flow cytometry gating on GFP-positive populations

What are the promising areas for future MS4A7 research in cancer immunotherapy?

Given the emerging understanding of MS4A7's role in immune function and cancer biology, several promising research directions include:

  • Exploring MS4A7 as a Biomarker:

    • Further validation of MS4A7 as a prognostic biomarker in different cancer types

    • Investigation of MS4A7 expression as a predictive biomarker for immunotherapy response

  • Targeting MS4A7 for Therapeutic Development:

    • As part of the "druggable genome" , MS4A7 could be explored as a direct therapeutic target

    • Development of antibodies or small molecules targeting MS4A7

    • CAR-T cell approaches targeting MS4A7 in cancers where it remains expressed

  • MS4A7 in Immune Modulation:

    • Investigating how MS4A7 affects macrophage polarization in the tumor microenvironment

    • Studying the impact of MS4A7 on dendritic cell function and antigen presentation

    • Exploring combinations of MS4A7-targeted therapies with existing immunotherapies

  • Mechanistic Studies:

    • Detailed investigation of MS4A7's role in signal transduction pathways

    • Identification of MS4A7 binding partners and how they affect immune function

    • Understanding the regulatory mechanisms controlling MS4A7 expression in different contexts

How might MS4A7 research contribute to our understanding of neuroinflammatory disorders?

While the direct role of MS4A7 in neuroinflammatory disorders isn't extensively documented in the provided search results, its family relationship to other MS4A genes implicated in neuroinflammation suggests potential contributions:

  • MS4A Family and Alzheimer's Disease:

    • Other MS4A family members (MS4A4A, MS4A6A) are associated with soluble TREM2 levels and Alzheimer's disease risk

    • Investigation of whether MS4A7 has similar associations with neuroinflammatory markers

  • Microglial Function:

    • MS4A genes encode transmembrane proteins expressed in microglia

    • Research into MS4A7's potential role in microglial activation and function

  • Comparative Studies:

    • Comparative analysis of MS4A7 versus other family members in neuroinflammatory contexts

    • Investigation of shared regulatory mechanisms among MS4A family members

  • Therapeutic Implications:

    • Exploring whether targeting MS4A7 could modulate neuroinflammation

    • Development of MS4A7-based biomarkers for neuroinflammatory disease progression

Methodological approaches for these investigations would include:

  • Single-cell RNA sequencing of microglia in health and disease

  • Brain organoid models for studying MS4A7 function in a human neural context

  • Mouse models with cell-type specific manipulation of MS4A7 expression

  • Correlative studies between MS4A7 variants and neuroinflammatory disease outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.