Recombinant Human Mesoderm-specific transcript homolog protein (MEST)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
MEST; PEG1; Mesoderm-specific transcript homolog protein; Paternally-expressed gene 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MEST
Target Protein Sequence
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQ
DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSI
FEQASIVEALLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI
FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIR
NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Uniprot No.
Target Background
Gene References Into Functions
Related Research:
- Methylation changes at specific CpG sites within MEST and DLK1 differentially methylated regions were observed in a preeclamptic group (PMID: 29157033).
- Growth-regulating imprinted genes, such as MEST and MEG3, exhibit susceptibility to non-imprinted allele expression during development and differentiation, unlike the strictly maintained intergenic differentially methylated region of PEG3 (PMID: 28854270).
- MEST demonstrates strong expression in invasive extravillous trophoblasts during the first trimester (PMID: 27697227).
- G4 formation at novel motifs within the MEST promoter, not previously identified through bioinformatic analysis, has been reported (PMID: 28052120).
- Altered DNA methylation at imprinted domains, including IGF2/H19 and PEG1/MEST, may mediate the association between human papillomavirus infection and invasive cervical cancer (PMID: 23775149).
- Significant correlations between miR-335 and MEST expression levels support the co-expression of the intronic miR-335 with its host gene (PMID: 23229728).
- Reduced DNA methylation levels at the H19 and MEST differentially methylated regions (DMRs) were observed in placentas from pregnancies conceived via IVF/ICSI compared to spontaneous conceptions (PMID: 23343754).
- Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1), along with global methylation levels, were not associated with idiopathic recurrent spontaneous miscarriages (PMID: 23415968).
- These findings suggest long-lasting epigenetic effects on offspring following intrauterine exposure to gestational diabetes mellitus (PMID: 23209187).
- MEST exhibits tissue-specific imprinting, showing paternal expression in skeletal muscle, fat, pituitary gland, heart, kidney, lung, stomach, and uterus, and maternal expression in spleen and liver (PMID: 22531794).
- In cortices, the MEST promoter was hemimethylated (characteristic of a differentially methylated imprinting control region), while the COPG2 and TSGA14 promoters were completely demethylated (typical of transcriptionally active non-imprinted genes) (PMID: 22456293).
- Regardless of conception method, a significantly higher PEG1 methylation percentage was observed in chorionic villus samples from spontaneous abortions compared to induced abortions and multifetal reductions (PMID: 21575949).
- Leiomyoma tumorigenesis is associated with overexpression of PEG1/MEST gene isoform 1, but not with loss of imprinting (PMID: 20339302).
- MEST gene imprinting occurs in an isoform-specific manner in adult lymphocytes (PMID: 10631159).
- The MEST gene demonstrates imprinting, with preferential expression from the paternal allele in fetal tissues (PMID: 9192843).
- PEG1/MEST can be excluded as a major determinant of Silver-Russell syndrome (PMID: 11754049).
- An imprinted PEG1/MEST antisense transcript is predominantly expressed in human testis and mature spermatozoa (PMID: 11821432).
- Mutation screening and imprinting analysis of candidate genes for autism in the 7q32 region (PMID: 11920156).
- A novel mechanism, a promoter switch, leads to biallelic expression in invasive breast cancer (PMID: 12023987).
- An intron containing MESTIT1, transcribed only from the paternal allele, may be involved in MEST regulation (PMID: 12095916).
- Loss of imprinting of PEG1/MEST may be associated with tumorigenesis and malignant transformation, especially in NSCLC (PMID: 15547750).
- PEG1 isoform 2 demonstrates imprinting in a significant subset of human placentae (PMID: 16338457).
- Hypermethylation of paternally expressed genes, including PEG1/MEST (with growth-promoting effects), may be relevant to low birth weight in subjects conceived through assisted reproductive techniques (PMID: 17450433).
- The type of epimutation at the PEG1/MEST locus does not play a significant role in Silver-Russell syndrome (PMID: 18585117).
- MEST localizes to the endoplasmic reticulum/Golgi apparatus, where its potential enzymatic properties as a lipase or acyltransferase are predicted based on sequence homology with members of the alpha/beta fold hydrolase superfamily (PMID: 18644838).
Database Links
Protein Families
AB hydrolase superfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in hydatidiform moles, but barely expressed in dermoid cysts. Biallelic expression is detected in blood lymphocytes. Seems to imprinted in an isoform-specific manner rather than in a tissue-specific manner in lymphocytes. Isoform 1 is exp
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
