Recombinant Human Metallophosphoesterase 1 (MPPE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MPPE1; PGAP5; PP579; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MPPE1
Target Protein Sequence
MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASD GEQTTREPVLKAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDI FDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSS ERLFSWKGINFVMVNSVALNGDGCGICSETEAELIEVSHRLNCSREARGSSRCGPGPLLP TSAPVLLQHYPLYRRSDANCSGEDAAPAEERDIPFKENYDVLSREASQKLLWWLQPRLVL SGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCYLPREDVVLII YCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR
Uniprot No.

Target Background

Function
Metallophosphoesterase 1 (MPPE1) is essential for the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It plays a critical role in GPI-anchor maturation by removing an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI intermediate. This enzymatic activity is crucial for the efficient trafficking of GPI-anchored proteins.
Gene References Into Functions
  1. This study suggests an association between an MPPE1 gene polymorphism and bipolar disorder. PMID: 19859903
  2. This publication details the cDNA cloning, genomic organization, and expression of the human MPPE1 gene located on chromosome 18p11.2. PMID: 11978971
  3. These findings indicate that the GPI glycan acts as an endoplasmic reticulum exit signal, and that glycan remodeling by PGAP5 regulates GPI-anchored protein transport in the early secretory pathway. PMID: 19837036
Database Links

HGNC: 15988

OMIM: 611900

KEGG: hsa:65258

STRING: 9606.ENSP00000465894

UniGene: Hs.712666

Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Note=Also localizes to endoplasmic reticulum exit site.
Tissue Specificity
Expressed in brain.

Q&A

What is the structural classification of MPPE1 and its functional domains?

MPPE1 (Metallophosphoesterase 1) is a member of the calcineurin-like phosphoesterase superfamily. The protein contains metal binding and active sites that share structural similarities with serine/threonine phosphoprotein phosphatase catalytic subunits . These domains are crucial for its enzymatic activity, which involves phosphate group hydrolysis. The structural elements of MPPE1 suggest its functional role as a metallophosphoesterase that requires metal ions as cofactors for catalytic activity. Understanding these structural components is essential for designing experiments that target specific domains to modulate MPPE1 function.

What cellular pathways involve MPPE1 under normal physiological conditions?

MPPE1 is primarily involved in regulating the transport of glycosylphosphatidylinositol-anchor proteins from the endoplasmic reticulum to the Golgi apparatus . This process is critical for proper protein trafficking and membrane protein localization within cells. The protein primarily localizes to the cytoplasm and membrane structures in various cell types, including liver cells, as demonstrated by immunohistochemistry studies. Researchers investigating MPPE1 should consider its role in protein transport when designing experiments to understand its cellular functions and potential dysregulation in disease states.

What are the recommended methods for detecting MPPE1 expression in tissue samples?

For detecting MPPE1 expression in tissue samples, researchers should consider a multi-modal approach. Immunohistochemistry has successfully demonstrated MPPE1 protein expression in the cytoplasm and membranes of liver cancer tissues . For quantitative analysis, RT-qPCR can be employed to measure MPPE1 mRNA levels. This approach was used in studies analyzing data from GEO and TCGA databases, which revealed significantly increased MPPE1 expression in HCC tumor samples compared to adjacent nontumor tissues . Western blotting with specific antibodies against MPPE1 provides additional confirmation of protein expression levels and can detect post-translational modifications.

What are the optimal conditions for MPPE1 knockdown experiments in hepatocellular carcinoma cell lines?

For effective MPPE1 knockdown in hepatocellular carcinoma cell lines, shRNA-mediated gene silencing has been successfully employed in multiple studies. Based on experimental evidence with HuH-7 and HepG2 cell lines, researchers should design at least two different shRNA constructs targeting MPPE1 to control for off-target effects . Lentiviral vectors (such as LV3) have shown efficient transduction in these cell lines. Post-transduction verification of knockdown efficiency should be performed using both RT-qPCR and Western blot analysis to confirm both transcriptional and translational suppression. Functional assays should be conducted 72 hours post-transduction when maximal knockdown effect was observed in published studies .

How does MPPE1 contribute to HCC development and recurrence?

MPPE1 plays a significant role in HCC development and recurrence through multiple mechanisms affecting cancer cell biology. Research has demonstrated that MPPE1 is overexpressed in HCC tumor samples compared to adjacent nontumor tissues, as verified through analysis of GEO and TCGA databases . Functionally, MPPE1 promotes HCC cell proliferation by regulating cell cycle progression from G0/G1 to S phase. Knockdown studies in HCC cell lines showed that reduced MPPE1 expression significantly inhibited cell proliferation and induced cell-cycle arrest, with an increased proportion of cells in G0/G1 phase and reduced cells in S phase . Additionally, MPPE1 appears to confer resistance to apoptosis, as its knockdown significantly increased the percentage of early and late apoptotic cells and increased PARP cleavage, a hallmark of apoptosis .

What is the clinical significance of MPPE1 mutation in HCC patient outcomes?

The MPPE1 missense mutation on chr18_11897016 (C/T) has significant clinical implications for HCC patients. This mutation occurs in the exonic region (NM_001242904:c.A248G:p.E83G) and is found at a higher frequency in recurrent HCC (18%) compared to primary HCC (8%) or benign liver disease with cirrhosis (3.5%) . Statistical analysis demonstrated that this mutation is significantly associated with HCC recurrence (P = .003) with an odds ratio of 5.93 (95% CI: 1.60–21.97) . In multivariate analysis, the MPPE1 mutation was identified as an independent risk factor for HCC recurrence (HR = 1.969; 95%CI = 1.043–3.714, P = .037) . Clinically, HCC patients with the MPPE1 mutation exhibited higher postoperative tumor recurrence rates (1-year: 53% vs. 28%; 2-year: 69% vs. 45%; 3-year: 69% vs. 56%) compared to those without the mutation (P = .02) .

How does MPPE1 influence tumor cell invasion and metastatic potential?

MPPE1 enhances tumor cell invasion and metastatic potential through regulation of epithelial-mesenchymal transition (EMT) and related cellular processes. Experimental evidence from knockdown studies in HuH-7 and HepG2 cells demonstrated that reduced MPPE1 expression significantly decreased both cell invasion and migration capabilities . At the molecular level, MPPE1 silencing led to significant upregulation of E-cadherin (P = .002) and downregulation of N-cadherin (P < .001) in HepG2 cells . This modulation of EMT marker expression suggests that MPPE1 normally promotes a mesenchymal phenotype in HCC cells, which is associated with enhanced invasiveness and metastatic potential. Researchers investigating MPPE1's role in metastasis should focus on these EMT-related mechanisms and consider examining additional EMT regulators and downstream effectors that might be modulated by MPPE1.

What signaling pathways are affected by MPPE1 knockdown in HCC cells?

MPPE1 knockdown in HCC cells affects multiple signaling pathways crucial for cancer cell survival and proliferation. Most notably, MPPE1 silencing impacts cell cycle regulation pathways, as evidenced by the increased proportion of cells in G0/G1 phase and decreased S phase cells in both HuH-7 and HepG2 cell lines . This suggests MPPE1 normally promotes cell cycle progression through the G1/S checkpoint. Additionally, MPPE1 knockdown activates apoptotic signaling pathways, demonstrated by increased PARP cleavage, a crucial marker of apoptosis execution . The EMT pathway is also significantly affected, with altered expression of E-cadherin and N-cadherin . While the specific upstream and downstream molecular mediators remain to be fully elucidated, these findings indicate MPPE1 likely integrates into multiple signaling networks that promote cancer cell survival, proliferation, and invasiveness.

What controls should be included when studying the effects of recombinant MPPE1 on cell proliferation?

When studying the effects of recombinant MPPE1 on cell proliferation, researchers should implement a comprehensive set of controls. First, include vehicle controls containing all buffer components except the recombinant protein to account for potential buffer effects. Second, use an irrelevant recombinant protein of similar size and purification method as a negative control to distinguish specific MPPE1 effects from general protein effects. Third, include positive controls known to affect proliferation, such as growth factors (e.g., EGF) or inhibitors. Fourth, implement dose-response experiments with at least five concentration points to establish the relationship between MPPE1 concentration and biological effect. Fifth, conduct time-course experiments measuring proliferation at multiple time points (24h, 48h, 72h, and 96h) to capture temporal dynamics of MPPE1 effects. For mechanistic validation, parallel experiments with MPPE1 knockdown or knockout cells should be performed to confirm specificity through opposite phenotypic effects.

How can researchers validate that the observed phenotypic changes are specific to MPPE1 modulation?

To validate that observed phenotypic changes are specific to MPPE1 modulation, researchers should employ multiple complementary approaches. First, use at least two different siRNA or shRNA sequences targeting different regions of MPPE1 mRNA to ensure consistent phenotypes while minimizing off-target effects . Second, perform rescue experiments by expressing an RNAi-resistant MPPE1 variant in knockdown cells; restoration of the original phenotype confirms specificity. Third, utilize CRISPR-Cas9 gene editing as an orthogonal approach to validate knockdown results. Fourth, demonstrate dose-dependency by correlating the degree of MPPE1 knockdown or overexpression with the magnitude of phenotypic changes. Fifth, perform epistasis experiments by modulating known downstream targets to determine if they can rescue the MPPE1-associated phenotype. Sixth, compare the effects of MPPE1 modulation across multiple cell lines to distinguish cell-type-specific from general effects.

What methods are recommended for detecting the MPPE1 missense mutation on chr18_11897016?

For detecting the MPPE1 missense mutation on chr18_11897016 (C/T), researchers should employ a multi-technique approach for reliable results. The primary detection method used in published research is PCR-MassARRAY, which has successfully identified this mutation in clinical samples . For validation, targeted Sanger sequencing of the specific region containing the mutation provides a confirmatory method. Next-generation sequencing approaches, such as whole-exome sequencing that originally identified this mutation, can be employed for comprehensive genetic profiling . For high-throughput screening of multiple samples, custom TaqMan SNP genotyping assays or digital PCR methods offer sensitive detection options. Researchers should also consider analyzing this mutation in the context of other genetic alterations by incorporating parallel detection of established HCC-associated mutations, such as those in TP53, which was found to be the most frequently mutated gene (41.0%) in HCC samples .

What are the best animal models for studying MPPE1 function in HCC progression?

For studying MPPE1 function in HCC progression, researchers should consider several complementary animal models. Xenograft models using immunodeficient mice (nude or NSG) injected with HCC cell lines with MPPE1 knockdown or overexpression have been successfully employed to assess tumor growth, as demonstrated in published research where transcriptional silencing of MPPE1 significantly reduced tumor weight and volume in vivo . For more advanced studies, orthotopic implantation of HCC cells into mouse liver provides a microenvironment that better recapitulates human disease. Genetically engineered mouse models (GEMMs) with liver-specific MPPE1 overexpression or knockout, potentially under inducible control, would allow evaluation of MPPE1's role in de novo HCC development. Patient-derived xenograft (PDX) models using HCC tissue with known MPPE1 mutation status would enable assessment of therapeutic interventions in a more clinically relevant context. For metastasis studies, tail-vein injection or intrasplenic injection models with cells of varying MPPE1 expression can be used to evaluate MPPE1's impact on metastatic colonization.

How can researchers accurately quantify MPPE1-mediated changes in tumor metastasis in animal models?

To accurately quantify MPPE1-mediated changes in tumor metastasis in animal models, researchers should implement a multi-parameter assessment approach. First, utilize bioluminescence imaging with luciferase-expressing HCC cells to allow non-invasive, longitudinal monitoring of metastatic spread and quantification of signal intensity across experimental groups. Second, perform comprehensive endpoint histopathological analysis of potential metastatic sites, with quantification of metastatic foci number, size, and distribution. Third, employ immunohistochemistry to assess MPPE1 expression in both primary tumors and metastatic lesions, correlating expression levels with metastatic burden. Fourth, analyze circulating tumor cells (CTCs) in blood samples using techniques like flow cytometry or PCR-based methods to quantify cells in the metastatic cascade. Fifth, implement molecular imaging techniques such as PET-CT with appropriate tracers to detect even small metastatic lesions. Sixth, conduct transcriptomic and proteomic analyses of primary tumors, metastatic lesions, and pre-metastatic niches to identify MPPE1-dependent alterations in metastasis-related pathways. For data analysis, employ appropriate statistical methods that account for the typically non-normal distribution of metastasis data.

What approaches show promise for targeting MPPE1 as a therapeutic strategy in HCC?

Based on the significant role of MPPE1 in HCC progression and recurrence, several therapeutic approaches warrant investigation. RNA interference (RNAi) strategies using siRNA or shRNA have shown efficacy in preclinical models, with MPPE1 knockdown significantly inhibiting cell proliferation, inducing cell cycle arrest and apoptosis in vitro, and reducing xenograft tumor growth in vivo . These findings suggest that MPPE1-targeted RNAi therapeutics could potentially be delivered via nanoparticles or lipid formulations. Small molecule inhibitors designed to target the metal binding or active sites of MPPE1 represent another promising approach, given that MPPE1 belongs to the calcineurin-like phosphoesterase superfamily with defined catalytic domains . Additionally, designing peptide inhibitors that disrupt MPPE1's protein-protein interactions in its regulatory pathways could provide specificity. For patients carrying the MPPE1 missense mutation (chr18_11897016, C/T), personalized approaches could include mutation-specific therapies or synthetic lethal strategies that exploit vulnerabilities created by this mutation .

How might MPPE1 mutation status be integrated into HCC patient stratification for clinical trials?

Integration of MPPE1 mutation status into HCC patient stratification for clinical trials requires a systematic approach that maximizes its prognostic and predictive value. First, prospective clinical trials should include MPPE1 mutation testing (particularly the chr18_11897016, C/T missense mutation) as part of baseline molecular profiling, given its significant association with HCC recurrence (HR = 1.969; 95%CI = 1.043–3.714, P = .037) . Second, stratification algorithms should incorporate MPPE1 mutation status alongside established clinical parameters (TNM stage, Child-Pugh classification) with which it has demonstrated significant associations (P = .002 and P = .039, respectively) . Third, trial designs should include pre-planned subgroup analyses comparing treatment outcomes between MPPE1-mutated and wild-type patients. Fourth, for trials investigating therapies targeting specific molecular pathways, researchers should analyze potential interactions between MPPE1 mutation status and pathway activity. Fifth, adaptive trial designs could be implemented where treatment assignment is modified based on MPPE1-associated biomarker responses. Sixth, post-treatment tissue collection should be mandated to assess changes in MPPE1 expression or mutation status as potential mechanisms of acquired resistance.

What are the primary technical challenges in developing recombinant MPPE1 protein for functional studies?

Development of recombinant MPPE1 protein for functional studies presents several technical challenges that researchers must address. First, as a metallophosphoesterase containing metal binding sites, proper protein folding during recombinant expression requires careful optimization of metal ion concentrations in culture media . Second, MPPE1's normal localization to cellular membranes suggests the presence of hydrophobic domains that may reduce solubility during purification, necessitating specialized solubilization strategies. Third, since MPPE1 is involved in glycosylphosphatidylinositol-anchor protein transport, it may undergo post-translational modifications that are critical for function but difficult to recapitulate in standard expression systems . Fourth, selecting an appropriate expression system is challenging - bacterial systems offer high yield but may lack essential eukaryotic modifications, while mammalian systems provide proper modifications but with lower yield. Fifth, designing a purification strategy that preserves enzymatic activity requires empirical testing of different buffer compositions, pH conditions, and stabilizing agents. Sixth, confirming that the recombinant protein maintains native enzymatic activity necessitates development of specific phosphoesterase activity assays relevant to MPPE1's biological function.

How can researchers address the challenges in studying MPPE1 interactions with other cellular components?

To effectively study MPPE1 interactions with other cellular components, researchers must implement specialized approaches that overcome several methodological challenges. First, for protein-protein interaction studies, proximity-based labeling methods like BioID or APEX can capture transient or membrane-associated interactions that might be missed by conventional co-immunoprecipitation, particularly relevant for MPPE1's role in protein trafficking between the endoplasmic reticulum and Golgi . Second, membrane yeast two-hybrid systems or split-ubiquitin assays are preferable to conventional yeast two-hybrid for studying MPPE1 interactions, given its membrane association. Third, for tracking dynamic interactions in live cells, researchers should utilize FRET or BRET approaches with carefully designed fluorescent protein fusions that don't disrupt MPPE1 localization or function. Fourth, to study MPPE1's role in cellular transport processes, pulse-chase experiments coupled with subcellular fractionation can track the movement of glycosylphosphatidylinositol-anchored proteins . Fifth, super-resolution microscopy techniques like STORM or PALM can reveal spatial relationships between MPPE1 and other cellular components at nanometer resolution. Sixth, for global interaction profiling, researchers should consider MS-based interactomics with careful attention to membrane protein solubilization and enrichment protocols.

What are the most promising unexplored research questions regarding MPPE1 in cancer biology?

Several high-priority unexplored research questions regarding MPPE1 in cancer biology warrant investigation. First, while MPPE1's role in HCC has been established, its potential involvement in other cancer types remains largely unexplored and should be systematically evaluated through pan-cancer expression and mutation analyses . Second, the precise biochemical function of MPPE1 and its natural substrates in normal and cancer cells remains undefined; identifying these substrates would significantly advance understanding of its mechanistic role. Third, the upstream regulators controlling MPPE1 expression and activity in cancer cells are unknown; characterizing these regulatory mechanisms could reveal additional therapeutic targets. Fourth, given MPPE1's involvement in protein trafficking, research should explore how it might influence the cell surface expression of growth factor receptors or adhesion molecules relevant to cancer progression . Fifth, the potential role of MPPE1 in modulating tumor microenvironment interactions, including immune cell recognition and function, represents an unexplored area with therapeutic implications. Sixth, the mechanistic link between the MPPE1 missense mutation (chr18_11897016, C/T) and enhanced tumor recurrence requires detailed biochemical and cellular investigation to determine if it creates a gain- or loss-of-function phenotype .

How might integrating MPPE1 research with other emerging areas in cancer biology lead to novel insights?

Integrating MPPE1 research with emerging areas in cancer biology could yield transformative insights through several promising intersections. First, combining MPPE1 functional studies with single-cell RNA sequencing could reveal cell-specific roles within the heterogeneous tumor microenvironment and identify MPPE1-dependent transcriptional programs. Second, exploring the relationship between MPPE1 and cancer metabolism is warranted, particularly given that phosphoesterases can influence metabolic signaling pathways; this could reveal whether MPPE1 contributes to the metabolic reprogramming characteristic of cancer cells. Third, investigating potential interactions between MPPE1 and non-coding RNAs could uncover regulatory networks controlling its expression in different cancer contexts. Fourth, applying proteogenomic approaches that correlate MPPE1 genetic variations with protein expression and post-translational modifications would provide a more comprehensive understanding of how genetic alterations influence MPPE1 function . Fifth, exploring MPPE1's potential role in cancer stem cell maintenance could explain its contribution to tumor recurrence and therapy resistance. Sixth, examining MPPE1 in the context of tumor immunology could determine whether it influences immune surveillance or response to immunotherapies, potentially explaining its clinical associations with aggressive disease .

Table 1: Association of MPPE1 Mutation with Clinical Parameters and Outcomes in HCC

ParameterMPPE1 Mutation StatusStatistical Significance
HCC RecurrenceSignificant association (OR = 5.93, 95% CI: 1.60–21.97)P = .003
TNM StageSignificant associationP = .002
Child–Pugh ClassificationSignificant associationP = .039
Independent Risk Factor for RecurrenceHR = 1.969; 95% CI = 1.043–3.714P = .037
1-year Recurrence Rate53% (with mutation) vs 28% (without mutation)P = .02
2-year Recurrence Rate69% (with mutation) vs 45% (without mutation)P = .02
3-year Recurrence Rate69% (with mutation) vs 56% (without mutation)P = .02

Table 2: Effects of MPPE1 Knockdown on HCC Cell Phenotypes

Cellular ProcessEffect of MPPE1 KnockdownModel SystemReference
Cell ProliferationSignificant inhibitionHuH-7 and HepG2 cells
Cell CycleG0/G1 phase arrest, reduced S phaseHuH-7 and HepG2 cells
ApoptosisIncreased early and late apoptosis, increased PARP cleavageHuH-7 and HepG2 cells
Cell InvasionSignificant reductionHuH-7 and HepG2 cells
Cell MigrationSignificant reductionHuH-7 and HepG2 cells
EMT MarkersIncreased E-cadherin (P = .002), Decreased N-cadherin (P < .001)HepG2 cells
Tumor Growth in vivoReduced tumor weight and volumeHepG2 xenografts in nude mice

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.