Recombinant Human Metalloreductase STEAP1 (STEAP1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Metalloreductase STEAP1

Recombinant Human Metalloreductase STEAP1, often referred to as STEAP1, is a protein that belongs to a family of metalloreductases. It is characterized by its six transmembrane domains and is predominantly expressed in prostate cancer and other malignancies. STEAP1 has been identified as a promising therapeutic target due to its tumor specificity and limited expression in normal tissues .

Structure and Function

FeatureDescription
Transmembrane DomainsSix
Prosthetic GroupHeme-b
NADPH BindingAbsent
Metalloreductase ActivityLimited without NADPH binding site

Expression and Clinical Significance

STEAP1 is highly expressed in prostate cancer, particularly in metastatic castration-resistant cases, making it a valuable target for therapeutic interventions . Its expression is also elevated in other cancers such as bladder, colorectal, and ovarian cancers, often correlating with aggressive tumor characteristics .

Cancer TypeExpression LevelClinical Significance
Prostate CancerHighTherapeutic target for metastatic castration-resistant cases
Bladder CancerElevatedAssociated with poor prognosis
Colorectal CancerElevatedLinked to tumor progression
Ovarian CancerElevatedCorrelates with aggressive characteristics

Therapeutic Applications

STEAP1 is being explored as a target for various anticancer strategies, including antibody-drug conjugates and chimeric antigen receptor T-cell (CAR-T) therapy. Recent clinical trials have shown promising results in targeting STEAP1 for prostate cancer treatment .

Therapeutic ApproachDescriptionClinical Outcomes
Antibody-Drug ConjugatesTargeted delivery of cytotoxic drugsPhase 1 trials show efficacy in metastatic castration-resistant prostate cancer
CAR-T Cell TherapyImmunotherapy targeting STEAP1Preclinical models demonstrate antitumor effects

Research Findings and Future Directions

Research AreaFindingsFuture Directions
Diagnostic MarkersSTEAP1 EVs elevated in prostate cancerInvestigate EVs for early detection and monitoring
Therapeutic TargetsSTEAP1 targeted therapies show promiseDevelop more efficient delivery systems and assess long-term efficacy

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5% to 50% glycerol.

Note: If you have specific requirements regarding the glycerol content, please indicate them in your order notes.

For lyophilized powder delivery forms, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
The protein can be delivered in either liquid or lyophilized powder form.

Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the protein according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-SUMO-tagged
Synonyms
STEAP1; PRSS24; STEAP; Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1
Datasheet & Coa
Please contact us to get it.
Expression Region
1-339aa
Mol. Weight
58.4kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Tags & Cell Markers
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Metalloreductase STEAP1 is an enzyme with the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It utilizes NAD(+) as an electron acceptor.
Gene References Into Functions
  1. High STEAP1 expression is associated with prostate cancer. PMID: 29464393
  2. Research suggests a strong foundation for further investigation into how STEAP1 activities may influence cancer progression. PMID: 27792302
  3. These findings emphasize the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression. PMID: 25453051
  4. Data indicate that STEAP1 is consistently overexpressed in malignant prostate tissue, specifically adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions. PMID: 24239460
  5. The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients. PMID: 24025158
  6. STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate. PMID: 23060075
  7. A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane. PMID: 22317770
  8. STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, indicating an unexpected oncogenic function of STEAP1. PMID: 22080479
  9. STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics. PMID: 22317770
  10. EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells. PMID: 22080479
  11. Data suggest that zoledronic acid may affect cancer cells by targeting the gene expression of STEAP. PMID: 19915386
  12. Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine. PMID: 15958640
  13. STEAP mRNA is used as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options. PMID: 18793824
  14. STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol. PMID: 18958632
  15. STEAPs may represent novel markers of mesenchymal stem cells in both humans and mice. PMID: 19196137

Show More

Hide All

Database Links

HGNC: 11378

OMIM: 604415

KEGG: hsa:26872

STRING: 9606.ENSP00000297205

UniGene: Hs.61635

Protein Families
STEAP family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.

Q&A

What is STEAP1 and what is its functional role in cancer biology?

STEAP1 belongs to the STEAP family of metalloreductases that can form homotrimers or heterotrimers with other STEAP proteins . Although the exact biological function of STEAP1 has not been fully determined, it is thought to play a role in cell adhesion and intracellular communication . In cancer contexts, STEAP1 has a well-established functional role in promoting cancer cell proliferation, invasion, and epithelial-to-mesenchymal transition .

Studies have demonstrated that STEAP1 knockdown in prostate cancer models counters androgen actions, inhibits proliferation, and induces apoptosis in tumor cells . Transcriptome analysis of STEAP1 knockout cells reveals significant downregulation of cell cycle progression pathways and metabolic processes including the Krebs cycle and glycolysis, which are rescued upon re-expression of STEAP1 . This is consistent with previous findings showing that STEAP1 knockdown in LNCaP prostate cancer cells impairs viability and proliferation while inducing apoptosis .

How is STEAP1 expression distributed across normal and cancerous tissues?

STEAP1 demonstrates a highly cancer-specific expression pattern that makes it an attractive therapeutic target. It is strongly expressed in over 80% of metastatic castration-resistant prostate cancer (mCRPC) with bone or lymph node involvement . Additionally, STEAP1 expression has been documented in 62% of Ewing sarcoma cases and multiple other cancer types .

In prostate cancer specifically, STEAP1 shows more consistent expression compared to other markers like Prostate-Specific Membrane Antigen (PSMA). A comparative analysis using immunohistochemistry H-scores found that 87.7% of evaluable matched mCRPC tissues demonstrated staining for STEAP1 compared to only 60.5% for PSMA . Importantly, STEAP1 expression shows less heterogeneity than PSMA, with 68% of patients showing STEAP1 expression across all metastatic sites versus 45% showing consistent PSMA expression .

Regarding tissue distribution, the mean STEAP1 H-score in bone metastases (193; 95% CI 171 to 215) was significantly higher than in lymph node metastases (difference −48; 95% CI −21 to −76; p < 0.001) and visceral metastases (difference −59; 95% CI −42 to −77; p < 0.001) .

What methodologies are available for measuring STEAP1 expression in research contexts?

Researchers can employ several complementary approaches to measure STEAP1 expression:

  • Immunohistochemistry (IHC): Useful for tissue samples, allowing semi-quantitative analysis through H-scores based on staining intensity multiplied by the percentage of positively stained cells . IHC enables assessment of expression patterns within tissue architecture and heterogeneity analysis.

  • Western Blotting: Provides protein-level expression data in cell lines and tissue lysates. This technique has been used to confirm STEAP1 expression in prostate cancer cell lines including LNCaP, C4-2B, and 22Rv1 .

  • Quantitative PCR (qPCR): Measures STEAP1 mRNA expression levels. This approach has been used to quantify approximately 65-80% reduction in STEAP1 expression following shRNA knockdown .

  • Flow Cytometry: Particularly useful for cell surface expression analysis using specific anti-STEAP1 antibodies. This method has been employed to confirm binding of STEAP1-targeting antibodies and to verify expression in various cell lines .

  • Transcriptome Analysis: RNA sequencing provides comprehensive gene expression data and can reveal pathways affected by STEAP1 expression or knockout .

What are the methodological considerations for developing STEAP1-targeting CAR T cell therapies?

Developing effective STEAP1-targeting CAR T cell therapies requires careful consideration of several methodological factors:

  • Antibody Selection and scFv Design: The starting point is identifying a specific antibody against STEAP1. Researchers have successfully identified antibody coding sequences from hybridomas to generate synthetic monoclonal antibodies confirming STEAP1 specificity . For CAR development, converting the antibody to a single-chain variable fragment (scFv) requires validation to ensure retention of specificity and binding properties .

  • CAR Design Optimization: The spacer length between the scFv and transmembrane domain significantly impacts CAR functionality. For STEAP1, studies have tested short, medium, and long spacer variants, finding that only the long spacer CAR demonstrated the anticipated antigen-specific pattern of activation . The inclusion of co-stimulatory domains such as 4-1BB has shown promising results in STEAP1 CAR development .

  • Expression Validation: Ensuring robust CAR expression across different donor peripheral blood mononuclear cells (PBMCs) and virus productions is essential. Flow cytometry can be used to measure expression levels .

  • Functional Assessment: STEAP1 CAR T cells should be evaluated for multiple functional readouts:

    • Cytokine production (IFN-γ, TNF-α, IL-2)

    • Proliferation upon antigen exposure

    • Cytolytic activity against STEAP1-positive target cells

    • Lack of activity against STEAP1-negative controls

  • Specificity Controls: Creating isogenic cell lines through STEAP1 knockout and rescue provides critical controls for specificity testing. Examples include using 22Rv1 STEAP1 knockout cells and DU145 cells engineered to express STEAP1 .

  • In Vivo Model Selection: Both subcutaneous and metastatic xenograft mouse models of prostate cancer have been used to evaluate STEAP1 CAR T activity, assessing tumor infiltration, growth inhibition, and survival extension .

How can researchers effectively create and validate STEAP1 knockout models?

Creating reliable STEAP1 knockout models requires systematic approaches:

  • CRISPR/Cas9 Genome Editing: This method has been successfully applied to generate STEAP1 knockout in the 22Rv1 human prostate cancer cell line . Design multiple guide RNAs targeting different exons of the STEAP1 gene to increase knockout efficiency.

  • shRNA Knockdown: Alternative to complete knockout, shRNA offers partial knockdown. Studies have targeted STEAP1 in LNCaP and C4-2B cells with multiple shRNAs, achieving 65-80% reduction in STEAP1 mRNA expression .

  • Rescue Model Generation: To confirm phenotypic effects are specifically due to STEAP1 loss, create rescue models by re-expressing STEAP1 in knockout lines via lentiviral transduction .

  • Validation Approaches:

    • Western blotting to confirm protein-level knockout

    • qPCR for mRNA expression verification

    • Flow cytometry to assess surface expression

    • Functional assays to evaluate biological impact

  • Isogenic Control Development: Generate paired lines (e.g., wildtype, knockout, and rescue) for controlled experiments that minimize confounding variables .

  • Transcriptome Analysis: RNA sequencing of isogenic lines (wildtype, knockout, rescue) provides insights into global impact of STEAP1 loss and rescue. This approach has revealed significant downregulation of ~1700 genes with STEAP1 knockout and upregulation of ~600 genes upon STEAP1 re-expression .

What methodological approaches can identify the molecular mechanisms of STEAP1 in cancer progression?

Understanding STEAP1's role in cancer progression requires multi-faceted approaches:

  • Transcriptome Profiling: RNA sequencing of isogenic cell lines with differential STEAP1 expression reveals affected pathways. Gene Set Enrichment Analysis (GSEA) has identified cell cycle progression, metabolic processes, and antigen processing/presentation pathways as significantly altered by STEAP1 modulation .

  • Cell Cycle Analysis: Apply validated gene signatures such as the 31-gene cell cycle progression (CCP) signature to transcriptome data. STEAP1 knockout shows significant downregulation of the CCP signature (score of −0.8) which increases substantially (to 0.5) with rescue of STEAP1 expression .

  • Metabolic Assays: Since STEAP1 affects metabolic pathways including the Krebs cycle and glycolysis, analyze metabolic parameters using:

    • Oxygen consumption rate measurement

    • Extracellular acidification rate analysis

    • Metabolite profiling by mass spectrometry

  • Invasion and Migration Assays: As STEAP1 promotes tumor invasion into the peritoneum in several cancer types, quantify cellular invasion using Transwell assays, wound healing assays, and 3D culture models .

  • Antigen Processing Investigation: Analyze MHC class I and II expression levels, as STEAP1 knockout significantly downregulates genes involved in antigen processing and presentation, including PSME1, TAP1, MR1, HLA-DQ-B1, and HLA-DQ-B2 .

  • In Vivo Metastasis Models: Utilize metastatic xenograft models to study STEAP1's role in metastatic spread, particularly focusing on bone metastases where STEAP1 expression is highest .

How does STEAP1 expression correlate with prostate cancer progression and treatment response?

STEAP1 demonstrates significant relationships with prostate cancer progression and therapy resistance:

  • Expression in Advanced Disease: STEAP1 is expressed in approximately 95% of patients with metastatic prostate cancer, with particularly high expression in bone metastases compared to lymph node or visceral metastases .

  • Prognostic Value: STEAP1 expression is associated with increased risk of prostate cancer relapse and high Gleason scores, making it useful for monitoring metastatic disease .

  • Correlation with AR Signaling: Positive correlation exists between STEAP1 and androgen receptor (AR) expression. Most patients with high STEAP1 expression demonstrate AR-positive prostate cancer (AR+/SYP- or AR+/SYP+), while those with no PSMA expression but STEAP1 positivity tend to have AR-null prostate cancer (AR-/SYP+ or AR-/SYP-) .

  • Treatment Resistance Mechanisms: STEAP1 loss following targeted therapy may contribute to further immunotherapy resistance through impaired antigen processing and presentation. Transcriptome analysis of tumors treated with STEAP1-targeting CAR T cells shows negative enrichment of pathways involved in MHC, cytotoxic lymphocytes, and T cell activation, along with marked downregulation of MHC class I and II genes .

  • Heterogeneity Patterns: Analysis using diversity metrics (hypergeometric, Simpson, and Shannon scores) reveals two main patterns of STEAP1 expression: 68% of patients show expression across all metastatic sites (high STEAP1) while 32% show heterogeneous expression. No patients completely lack STEAP1 expression across all sites .

What are the key considerations for evaluating STEAP1-targeting therapeutics in preclinical models?

Effective preclinical evaluation of STEAP1-targeting therapeutics requires:

  • Model Selection:

    • Cell line models with varying STEAP1 expression levels (e.g., 22Rv1, LNCaP, C4-2B for positive; PC-3, DU-145 for negative)

    • Isogenic knockout and rescue models to confirm specificity

    • Both subcutaneous and metastatic xenograft models to assess different aspects of therapeutic efficacy

  • Antigen Density Assessment: Evaluate therapeutic efficacy across target cells with different STEAP1 expression levels to determine minimum threshold for therapeutic response .

  • Heterogeneity Consideration: Based on patient data showing variable STEAP1 expression patterns, models should reflect intra-tumoral and inter-metastatic heterogeneity to predict treatment escape mechanisms .

  • Resistance Mechanisms: Monitor for antigen loss and MHC downregulation as potential resistance mechanisms to STEAP1-targeted immunotherapies .

  • Combination Strategies: Test STEAP1-targeting therapeutics in combination with treatments addressing resistance mechanisms, particularly those targeting antigen presentation pathway components .

  • Comparative Assessment: Benchmark against other prostate cancer targets such as PSMA. Data suggests STEAP1 may offer broader coverage of prostate cancer cases (87.7% vs. 60.5% for PSMA) .

  • Long-term Monitoring: Assess duration of response and mechanisms of escape, as studies have identified that tumors can develop STEAP1 loss during long-term culture or following therapeutic pressure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.