Recombinant Human Metalloreductase STEAP3 (STEAP3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Human STEAP3 is a purified form of the six-transmembrane metalloreductase encoded by the STEAP3 gene. It catalyzes the reduction of Fe³⁺ to Fe²⁺ and Cu²⁺ to Cu⁺, enabling cellular iron uptake and copper homeostasis . STEAP3 localizes to endosomes and interacts with transferrin (Tf), transferrin receptor 1 (TfR1), and divalent metal transporter 1 (DMT1) to facilitate iron recycling in erythroid cells . Its recombinant form is expressed in systems like E. coli or HEK293T cells, often fused with tags (e.g., His, GST) for purification .

Table 1: Recombinant STEAP3 Protein Variants

SourceHostTagPurityApplicationsReference
Creative BioMartE. coliHis>90%Structural studies, assays
ElabscienceE. coliGST/His>95%Functional assays
Boster BioHEK293TMyc/DDKN/ASignaling studies

3.1. Iron and Copper Homeostasis

STEAP3 is essential for erythroid iron uptake and exosome-mediated protein secretion . Overexpression increases intracellular Fe²⁺, activating Wnt/β-catenin signaling in colorectal cancer (CRC) .

3.2. Cancer Biology

  • Hepatocellular Carcinoma (HCC): Nuclear STEAP3 promotes EGFR-RAC1-ERK-STAT3 signaling, enhancing tumor proliferation and stemness .

  • Prostate Cancer: STEAP3 was initially identified as a prostate cancer immunotherapy target .

3.3. Viral and Metabolic Diseases

  • PRRSV Inhibition: Overexpression reduces Porcine Reproductive and Respiratory Syndrome Virus replication by modulating fatty acid synthesis and lipid droplet formation .

  • NAFLD Pathogenesis: STEAP3 deletion ameliorates hepatic steatosis by suppressing MAPK/TAK1 pathways .

Table 2: Selected Studies on Recombinant STEAP3

Study FocusModel SystemKey OutcomeReference
Lipid Metabolism in PRRSVMARC-145 cellsSTEAP3 inhibits FASN expression, reducing viral replication via lipid regulation
NAFLD MechanismHFD-fed miceSTEAP3 knockout reduces hepatic lipid accumulation via TAK1/JNK inhibition
HCC ProgressionHCC cell linesNuclear STEAP3 enhances EGFR-STAT3 signaling, driving tumor stemness

Mechanistic Insights

  • Exosome Regulation: STEAP3 facilitates exosomal trafficking, influencing tumor microenvironment communication .

  • Inflammatory Pathways: Modulates macrophage polarization and ferroptosis via iron redistribution .

Future Directions

Research gaps include elucidating STEAP3’s role in copper-dependent pathways and its potential as a biomarker for cirrhosis-to-HCC progression . Therapeutic strategies targeting STEAP3 in metabolic and oncologic diseases are under exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
STEAP3; TSAP6; Metalloreductase STEAP3; Dudulin-2; Six-transmembrane epithelial antigen of prostate 3; Tumor suppressor-activated pathway protein 6; hTSAP6; pHyde; hpHyde
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-488
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQ EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA LAEKTSHV
Uniprot No.

Target Background

Function
STEAP3 is an endosomal ferrireductase crucial for efficient transferrin-dependent iron uptake in erythroid cells. It plays a role in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+). STEAP3 can also reduce Cu(2+) to Cu(1+), suggesting its involvement in copper homeostasis. It utilizes NADP(+) as an electron acceptor. STEAP3 may also function downstream of p53/TP53, connecting apoptosis and cell cycle progression. Additionally, it indirectly contributes to exosome secretion by facilitating the secretion of proteins like TCTP.
Gene References Into Functions
  1. In hepatocellular carcinoma (HCC), lower STEAP3 copper reductase expression and increased heavy Cu isotope enrichment have been observed in the tumor mass compared to surrounding tissue. PMID: 28303916
  2. Overexpression of TSAP6 is linked to poor survival in metastatic high-grade serous carcinoma. PMID: 27825812
  3. Heterozygous STEAP3 mutations are relatively common in humans, but their deleterious effect in humans remains to be confirmed. PMID: 26675350
  4. TSAP6 is a target of rhomboid protease RHBDD1-induced proteolysis. PMID: 22624035
  5. Findings suggest that STEAP3 maintains iron storage in human malignant cells and tumor proliferation under iron-deficient conditions. PMID: 21871451
  6. TSAP6 might augment Myt1 activity and act downstream to p53 to interface apoptosis and cell-cycle progression. PMID: 12606722
  7. TSAP6 plays a role in the export of TCTP, suggesting a general role for this multipass membrane protein in regulating vesicular trafficking and secretion. PMID: 15319436
  8. The crystal structure of the human Steap3 oxidoreductase domain was determined in the absence and presence of NADPH. PMID: 18495927
  9. Down-regulated expression of the TSAP6 protein in the liver is associated with the transition from cirrhosis to hepatocellular carcinoma. PMID: 19236508

Show More

Hide All

Database Links

HGNC: 24592

OMIM: 609671

KEGG: hsa:55240

STRING: 9606.ENSP00000376822

UniGene: Hs.647822

Involvement In Disease
Anemia, hypochromic microcytic, with iron overload 2 (AHMIO2)
Protein Families
STEAP family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Note=Localizes to vesicular-like structures at the plasma membrane and around the nucleus.
Tissue Specificity
Expressed in adult bone marrow, placenta, liver, skeletal muscle and pancreas. Down-regulated in hepatocellular carcinoma.

Q&A

What is the basic structure of STEAP3?

STEAP3 comprises an N-terminal cytosolic oxidoreductase domain and a C-terminal heme-containing transmembrane domain. The oxidoreductase domain shows limited but remarkable homology to FNO, an archaeal oxidoreductase. Crystal structures reveal a twofold symmetric dimer in the asymmetric unit, with NADPH and flavin serving as predicted cofactors for its reductase activity. The protein's N-terminal residues 1-28 are disordered in crystal structures, suggesting they may be unnecessary for oxidoreductase activity, while the C-terminal residues form a membrane-proximal face that facilitates electron transfer . This structural arrangement uniquely positions STEAP3 to direct electron transfer from cytosolic NADPH through a flavin intermediate to the transmembrane domain.

What cellular roles does STEAP3 play in iron metabolism?

STEAP3 functions as the major ferrireductase in erythrocyte endosomes, playing a crucial role in the daily production of 200 billion erythrocytes that requires approximately 20 mg of iron, accounting for nearly 80% of human iron demand. Within endosomes, STEAP3 reduces Fe³⁺ to Fe²⁺, which can then be transported across the endosomal membrane by divalent metal iron transporter 1 . This reduction step is essential for efficient iron utilization from transferrin, which binds to transferrin receptors at the cell surface and enters endosomes via receptor-mediated endocytosis. The endosomal acidification triggers iron release from transferrin, making it available for STEAP3-mediated reduction and subsequent transport.

Where is STEAP3 primarily expressed?

STEAP3 mRNA is expressed at significantly higher levels in macrophages and hepatocytes compared to other STEAP family members. In bone marrow-derived macrophages (BMDMs), STEAP3 expression is over 200-fold higher than STEAP1, STEAP2, and STEAP4. In primary cultured mouse hepatocytes, STEAP3 is again the most highly expressed STEAP family member, with expression levels even greater than in BMDMs . This expression pattern highlights STEAP3's particular importance in cells responsible for iron storage, recycling, and homeostasis. The predominant expression in macrophages also suggests a potential role in immune function, as these cells coordinate both iron metabolism and inflammatory responses.

How does the STEAP3 oxidoreductase domain structure relate to its electron transfer function?

The crystal structure of human STEAP3 oxidoreductase domain, determined in both the absence (apo-STEAP3) and presence of NADPH (STEAP3-NADPH), reveals sophisticated structural adaptations for electron transfer. The structure shows an FNO-like domain with an unexpected dimer interface and strategically positioned substrate binding sites. These binding sites are optimally arranged to direct electron transfer from cytosolic NADPH through a flavin intermediate to the heme moiety in the transmembrane domain . Notably, STEAP3 utilizes Pro205 to truncate the C-terminal α-helix (α9), which extends at an oblique angle toward the membrane on the membrane-proximal face. This arrangement, along with the more compact α5 helix that replaces the β-hairpin extension in FNO, allows the nicotinamide ring to approach the membrane surface more closely, thereby facilitating efficient electron transfer to the intramembrane heme .

How is STEAP3 regulated during inflammatory responses?

STEAP3 exhibits unique regulation during inflammatory responses compared to other STEAP family members. In macrophages stimulated with LPS (an agonist for TLR4), STEAP3 mRNA declines markedly after 24 hours of treatment . In contrast, STEAP4 is upregulated by LPS at very early time points, while STEAP1 and STEAP2 show transient increases after LPS stimulation. The downregulation of STEAP3 appears to be mediated by soluble factors secreted by macrophages after LPS stimulation, suggesting a paracrine regulatory mechanism . This differential regulation implies that STEAP3 downregulation might contribute to iron sequestration in macrophages during inflammatory responses, a critical aspect of the body's nutritional immunity against pathogens.

What role does STEAP3 play in coordinating iron metabolism and immune responses?

STEAP3 functions at the intersection of iron metabolism and immunity, with significant implications for host defense. STEAP3 depletion leads to impaired induction of interferon-β, monocyte chemoattractant protein-5, and interferon-induced protein-10 in macrophages via the TLR4-mediated signaling pathway . During infections, available free iron decreases and becomes sequestered in cells of the reticuloendothelial system, especially macrophages, due to inflammatory signaling cascades. Iron is required by host cells for normal cellular function and immune-mediated defense mechanisms, and iron homeostasis can affect macrophage effector functions that influence downstream innate and adaptive immune responses . STEAP3's role in regulating iron availability therefore has direct consequences for immune function.

What expression systems are optimal for producing recombinant STEAP3?

Multiple expression systems can be employed for producing recombinant STEAP3, each with distinct advantages depending on research objectives. For structural studies requiring high protein yield, E. coli expression systems may be suitable for producing the N-terminal oxidoreductase domain (AA 1-258) . For full-length protein (AA 1-488) that requires proper folding and post-translational modifications, mammalian expression systems such as HEK-293 cells provide better quality protein with >90% purity as determined by Bis-Tris PAGE and analytical SEC . Cell-free protein synthesis (CFPS) systems offer another alternative, particularly for rapid production of protein variants, though typically with lower yields (>70-80% purity) . The choice of expression system should align with experimental requirements for protein quantity, purity, and biological activity.

What purification strategies yield highest purity recombinant STEAP3?

Affinity tag-based purification represents the most efficient approach for obtaining pure recombinant STEAP3. One-step Strep-tag purification can be effectively used for proteins expressed in cell-free expression systems, while His-tag purification works well for proteins expressed in both bacterial and mammalian systems . For analytical purposes, the purity of recombinant STEAP3 preparations should be assessed through multiple complementary methods: SDS-PAGE or Bis-Tris PAGE for general protein profile, Western blot for specific detection, anti-tag ELISA for quantification, and analytical size exclusion chromatography (SEC) by HPLC for native state assessment . These combined approaches can reliably achieve purities of >90% for mammalian-expressed STEAP3 and >70-80% for cell-free expressed protein.

What experimental models are most effective for studying STEAP3 function in vivo?

STEAP3-knockout (STEAP3-/-) mouse models provide the most comprehensive system for investigating STEAP3's physiological roles. These models allow for the isolation of bone marrow-derived macrophages (BMDMs) and primary cultured hepatocytes to study cell-specific effects of STEAP3 deficiency . Comparative analyses between wild-type and knockout models can reveal STEAP3's functions in iron homeostasis and inflammatory responses. For assessing iron metabolism specifically, multiple complementary assays should be employed: tissue iron content measurement, ferritin protein level analysis (for iron storage assessment), calcein assay (for cytosolic iron measurement), and expression analysis of iron metabolism genes . Additionally, inflammatory challenges with agents like LPS can reveal STEAP3's role in coordinating iron metabolism with immune responses in these models.

How can ferrireductase activity be accurately measured in STEAP3 studies?

Ferrireductase activity assays represent a critical methodology for functional assessment of STEAP3. These assays typically measure the reduction of Fe³⁺ to Fe²⁺ using colorimetric or fluorometric detection systems. In studies of STEAP3-deficient macrophages and hepatocytes, researchers found significant reductions in ferrireductase activity compared to wild-type controls . While the specific protocol details are not fully described in the search results, standard approaches often involve incubating cells or purified protein with ferric iron compounds and measuring the production of ferrous iron using chelators like ferrozine or bathophenanthroline disulfonate that form colored complexes with Fe²⁺. For recombinant protein studies, activity assays should include appropriate controls for cofactor requirements (NADPH, flavins) and optimize pH conditions to match the endosomal environment where STEAP3 naturally functions.

What crystallization techniques have been successful for STEAP3 structural studies?

The crystal structure of STEAP3 oxidoreductase domain was successfully determined using hanging drop vapor diffusion techniques. Specifically, researchers used equal volumes of protein and well solution containing 10 mM FeCl₃, 60–100 mM Na₃-citrate (pH 5.6), 4% Jeffamine M600, and 15% glycerol . Crystals were also successfully grown in the presence of 1 mM NADPH using the same conditions. Prior to data collection, crystals were flash-frozen in liquid nitrogen. The structure of apo-STEAP3 was solved by multiple isomorphous replacement with anomalous scattering (MIRAS), with heavy atom soaks performed for 1 hour in 10 mM K₂Pt(CN)₄ or 10 mM mersalyl acid . For researchers attempting to crystallize STEAP3, these conditions provide a valuable starting point, though optimization may be necessary depending on the specific construct used.

How can one assess the impact of STEAP3 variants on cellular iron distribution?

To evaluate how STEAP3 variants affect cellular iron distribution, researchers should implement a multi-faceted approach combining several complementary techniques. First, total cellular iron content can be measured using colorimetric assays or atomic absorption spectroscopy. Second, the calcein assay provides a means to specifically assess cytosolic iron levels—when calcein binds to iron, its fluorescence is quenched, making it an effective probe for labile iron pools . Third, ferritin protein levels (both H and L subunits) serve as indicators of iron storage status and can be quantified by Western blot. Finally, subcellular fractionation followed by iron measurement in different cellular compartments can reveal how STEAP3 variants affect iron distribution across organelles . In STEAP3-deficient cells, these approaches have revealed complex patterns where total iron may increase while cytosolic iron availability decreases, highlighting the importance of compartment-specific analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.