Recombinant Human metapneumovirus Fusion glycoprotein F0 (F)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Metapneumovirus Fusion Glycoprotein F0 (F)

Human metapneumovirus (hMPV) is a prevalent cause of lower respiratory tract infections, especially in young children and the elderly . The fusion glycoprotein F, found on the surface of the virus, plays a vital role in the virus's ability to enter host cells, making it a primary target for neutralizing antibodies . The F glycoprotein facilitates the fusion of the virus and cell membranes, which is essential for the virus to infect cells .

Structure and Function of hMPV F0 Glycoprotein

The hMPV F glycoprotein is synthesized as a precursor protein called F0, which needs to be cleaved to become functional . This cleavage results in two subunits, F1 and F2, that remain connected by disulfide bonds . The mature F protein is a trimer composed of these F1 and F2 heterodimers . The F glycoprotein goes through significant changes during membrane fusion, transitioning from a metastable pre-fusion to a stable post-fusion conformation .

Key structural and functional aspects of the hMPV F0 glycoprotein:

  • Cleavage: The F0 precursor is cleaved by trypsin-like proteases into F1 and F2 subunits .

  • Fusion Peptide: The F1 subunit contains a hydrophobic sequence called the fusion peptide that inserts into the target cell membrane .

  • Conformational Change: During fusion, the F protein refolds, bringing the fusion peptide in proximity to the C-terminal region, which drives the fusion of viral and cellular membranes .

  • pH Independence: The fusion process is pH-independent and can occur at the plasma or endosomal membrane .

  • Host Cell Attachment: The F protein trimer facilitates attachment to the host cell by binding to heparan sulfate .

Immunogenicity and Neutralizing Antibodies

The hMPV F glycoprotein is a key target for neutralizing antibodies, making it a critical component for vaccine development . Antibodies that target specific sites on the F protein can prevent the virus from entering cells, thus neutralizing the infection .

  • The pre-fusion conformation of hMPV F has a dense glycan shield at its apex, which may limit the host's immune response to this site .

  • Both pre-fusion and post-fusion forms of the F protein can induce high levels of neutralizing antibodies .

  • Stabilizing the prefusion form of F can enhance the immunogenicity of quaternary-specific responses .

Recombinant Production and Characterization

Recombinant hMPV F glycoproteins are produced using various expression systems to study their structure, function, and potential as vaccine candidates . These recombinant proteins can be engineered with modifications such as stabilization mutations or tags for purification and detection .

Common features of recombinant hMPV F0 glycoprotein products:

FeatureDescription
Expression SystemBaculovirus, HEK293 cells, or Yeast
TagC-terminal His-tag for purification
PurityTypically >85% as determined by SDS-PAGE
Molecular WeightApproximately 12.2 kDa for partial fragments
FormAvailable in liquid or lyophilized powder
Storage ConditionsStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
Target FunctionFacilitates viral and plasma cell membrane fusion; mediates attachment to host cells
Subcellular LocationVirion membrane; Host cell membrane

Research Findings and Significance

Research on the hMPV F glycoprotein has provided valuable insights into the virus's entry mechanism and immune response . Studies have focused on:

  • Structural Determination: X-ray crystallography and cryo-EM have been used to determine the structure of hMPV F in both pre-fusion and post-fusion conformations .

  • Stabilization Strategies: Engineering stabilized versions of the F protein to improve its potential as a vaccine antigen .

  • Epitope Mapping: Identifying key epitopes on the F protein that are targeted by neutralizing antibodies .

  • Cross-Reactivity: Investigating cross-reactivity between hMPV and related viruses like human respiratory syncytial virus (hRSV) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
F; Fusion glycoprotein F0; Protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-539
Protein Length
Full Length of Mature Protein
Species
Human metapneumovirus (strain CAN97-83) (HMPV)
Target Names
F
Target Protein Sequence
LKESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCSDGPSLIKTELDLTKSAL RELKTVSADQLAREEQIENPRQSRFVLGAIALGVATAAAVTAGVAIAKTIRLESEVTAIK NALKTTNEAVSTLGNGVRVLATAVRELKDFVSKNLTRAINKNKCDIDDLKMAVSFSQFNR RFLNVVRQFSDNAGITPAISLDLMTDAELARAVSNMPTSAGQIKLMLENRAMVRRKGFGI LIGVYGSSVIYMVQLPIFGVIDTPCWIVKAAPSCSGKKGNYACLLREDQGWYCQNAGSTV YYPNEKDCETRGDHVFCDTAAGINVAEQSKECNINISTTNYPCKVSTGRHPISMVALSPL GALVACYKGVSCSIGSNRVGIIKQLNKGCSYITNQDADTVTIDNTVYQLSKVEGEQHVIK GRPVSSSFDPIKFPEDQFNVALDQVFENIENSQALVDQSNRILSSAEKGNTGFIIVIILI AVLGSSMILVSIFIIIKKTKKPTGAPPELSGVTNNGFIPHS
Uniprot No.

Target Background

Function

Inactive precursor cleaved to yield mature F1 and F2 fusion glycoproteins; a Class I viral fusion protein. Current models suggest at least three conformational states: pre-fusion native, pre-hairpin intermediate, and post-fusion hairpin. During viral and plasma membrane fusion, coiled-coil regions form a trimer-of-hairpins structure, bringing the fusion peptide near the ectodomain's C-terminus. This structure drives membrane apposition and fusion, delivering the nucleocapsid into the cytoplasm. Fusion is pH-independent and occurs at the plasma or endosomal membrane. The F1-F2 trimer (F protein) also mediates attachment to host cells via heparan sulfate binding. It is a major determinant of RSV infection's species specificity.

Database Links

KEGG: vg:2799939

Protein Families
Paramyxoviruses fusion glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass membrane protein.

Q&A

How does HMPV F protein differ functionally from other paramyxovirus fusion proteins?

Unlike most paramyxoviruses that require two viral glycoproteins for entry (an attachment protein and a fusion protein), HMPV F is unique in that it can independently drive fusion without a separate viral attachment protein. This means HMPV F can perform dual functions of attachment and fusion, making it essential for virus entry and infection . This functional characteristic is shared with respiratory syncytial virus (RSV), as both belong to the Pneumovirus subfamily, but differs from other paramyxoviruses that require separate attachment proteins.

What conformational changes does HMPV F undergo during the fusion process?

HMPV F undergoes dramatic conformational changes transitioning from a metastable pre-fusion state to a stable post-fusion state. This refolding process couples energy release to membrane fusion. The pre-fusion conformation can be stabilized experimentally with a GCN4-derived trimerization tag, while the post-fusion conformation represents an elongated, thermostable structure . During fusion, the hydrophobic fusion peptide is exposed and inserted into the target cell membrane, followed by refolding into a six-helix bundle that brings viral and cellular membranes together for fusion.

What expression systems are most effective for producing recombinant HMPV F0 protein?

For research purposes, several expression systems have been successfully employed to produce recombinant HMPV F0 protein:

  • Mammalian cell expression systems: These are frequently preferred as they provide proper post-translational modifications, especially glycosylation patterns that are important for maintaining native conformation and immunogenicity. Commonly used cell lines include HEK293 and CHO cells.

  • Insect cell expression systems: Baculovirus expression systems using Sf9 or High Five insect cells provide high yields of recombinant protein with mammalian-like glycosylation patterns, though not identical to native human patterns.

The presence of a signal peptide and a C-terminal trimerization domain (such as a GCN4 motif) is often incorporated to enhance proper folding and trimerization of the expressed protein .

What strategies help prevent aggregation of recombinant HMPV F protein during purification?

Recombinant HMPV F protein, particularly in the post-fusion conformation, tends to aggregate due to exposed fusion peptides forming rosettes of trimers. Several strategies can minimize this aggregation:

  • Fusion peptide deletion: Deleting the first 9 amino acids of the fusion peptide (residues 137-146) has been shown to produce monodispersed trimers in the post-fusion state .

  • Stabilizing mutations: Introduction of specific mutations that stabilize either the pre-fusion or post-fusion conformations can reduce aggregation tendencies.

  • Optimized buffer conditions: Using buffers with appropriate ionic strength, pH, and detergents can minimize aggregation during purification.

  • Addition of trimerization domains: GCN4-derived trimerization tags can stabilize the trimeric structure and reduce nonspecific aggregation .

How can researchers assess the quality and conformational integrity of purified recombinant HMPV F0?

Multiple analytical techniques should be employed to assess the quality and conformational integrity of purified recombinant HMPV F0:

  • Size exclusion chromatography (SEC): Evaluates the homogeneity and oligomeric state of the protein, with properly folded F protein typically eluting as a trimer.

  • Negative stain electron microscopy: Provides direct visualization of protein conformation, distinguishing between pre-fusion and post-fusion states .

  • Conformational antibody binding assays: Using conformation-specific antibodies that recognize either pre-fusion or post-fusion epitopes via ELISA or surface plasmon resonance.

  • Thermal stability assays: Differential scanning calorimetry or thermal shift assays can assess the stability of the protein and confirm proper folding.

  • Functional assays: Cell fusion assays can confirm that the recombinant protein retains biological activity.

What are the most reliable methods for propagating HMPV in laboratory settings?

HMPV propagation in laboratory settings is challenging due to its slow replication. The following optimized approach has shown success:

  • Cell line selection: Vero E6 cells, a Vero cell clone particularly suited for slow-replicating viruses, have demonstrated good sensitivity to HMPV infection .

  • Media supplementation: DMEM supplemented with 1-2% FBS and 3-5 μg/ml of trypsin (TPCK-treated) is essential, as trypsin mimics the proteolytic activation of the F protein that promotes viral infection .

  • Infection parameters:

    • Seed Vero E6 cells at 1.5 × 10^5 cells/ml in DMEM with 10% FBS

    • Allow 18-24 hours for cell attachment at 37°C, 5% CO2

    • Wash with sterile PBS before inoculation

    • Inoculate with virus at low MOI (0.001) in serum-free DMEM with trypsin

    • Incubate for 1 hour at 35°C, 5% CO2 for virus adsorption

    • Add DMEM with 2% FBS and 5 μg/ml trypsin

    • Monitor cells daily until 70-80% cytopathic effect (CPE) is observed

  • Virus harvesting: Collect supernatant and scrape remaining cell layer; subject cell pellet to freeze-thaw cycles; centrifuge and collect supernatant; store with 20% sucrose at -80°C .

What neutralization assays are most effective for evaluating antibodies against HMPV F?

An ELISA-based microneutralization (EMN) assay has proven effective for evaluating antibodies against HMPV F protein. The validated protocol includes:

  • Cell preparation: Seed Vero E6 cells at 2.0 × 10^5 cells/ml in DMEM with 2% FBS 24 hours before the test.

  • Serum preparation: Dilute serum samples to a final concentration of 1:10, followed by serial two-fold dilutions.

  • Virus-serum incubation: Add appropriate virus dose to each serum dilution and incubate for 1 hour at 35°C, 5% CO2.

  • Infection: Transfer 100 μl of virus-serum mixture to pre-seeded cell plates and incubate (24 hours for HMPV-A1, 48 hours for HMPV-B1).

  • Detection: Use ELISA with appropriate primary and secondary antibodies (typically at 1:1000 dilution) to detect viral infection .

This assay provides a semi-quantitative measurement of neutralizing antibody titers and has been validated for both HMPV-A1 and HMPV-B1 strains.

How can researchers effectively stabilize different conformational states of HMPV F for structural and immunological studies?

Stabilizing different conformational states of HMPV F is critical for structural and immunological studies:

Pre-fusion conformation stabilization:

  • Addition of GCN4-derived trimerization tags to the C-terminus

  • Introduction of disulfide bonds to prevent premature triggering

  • Cavity-filling hydrophobic substitutions to stabilize the pre-fusion state

  • Maintaining proper pH and temperature conditions during purification

Post-fusion conformation stabilization:

  • Deletion of fusion peptide residues (e.g., residues 137-146) to prevent aggregation

  • Heat treatment to trigger the conformational change to post-fusion state

  • Use of stabilizing buffer conditions during purification

These stabilization methods allow for the production of homogeneous protein preparations suitable for crystallography, electron microscopy, and immunization studies.

What epitopes on HMPV F are most important for neutralizing antibody responses?

Several key epitopes on HMPV F have been identified as targets for neutralizing antibodies:

  • Antigenic site IV: This site is targeted by potently neutralizing antibodies such as DS7, which binds to a structurally invariant domain of F that is conserved in both pre-fusion and post-fusion conformations .

  • Pre-fusion specific epitopes: Similar to RSV F, antibodies targeting pre-fusion-specific epitopes on HMPV F typically display higher neutralizing potency.

  • Quaternary epitopes: Some antibodies, similar to motavizumab for RSV, likely contact residues on two protomers of the F trimer, indicating quaternary epitopes that depend on the proper assembly of the trimeric structure .

  • Conserved regions across HMPV subtypes: The F protein contains domains that are highly conserved among all HMPV subtypes, facilitating the development of treatments with broad-spectrum activity .

Interestingly, unlike RSV, the G protein of HMPV induces a poorly protective antibody response, making F protein the primary target for vaccine development .

How do virus-like particles (VLPs) containing HMPV F compare to other vaccine approaches?

Virus-like particles (VLPs) containing HMPV F represent a promising vaccine approach with several advantages:

  • Immune response profile: VLP immunization induces both F-specific antibody responses and CD8+ T cells recognizing F protein-derived epitopes.

  • Neutralizing antibody induction: VLPs can induce neutralizing antibody responses that can be enhanced with appropriate adjuvants like TiterMax Gold or α-galactosylceramide.

  • Protection level: Two doses of VLPs have been shown to confer complete protection from HMPV replication in mouse lungs.

  • Balanced immune response: VLP immunization is not associated with Th2-skewed cytokine responses, which have been problematic in some previous RSV vaccine attempts .

Compared to traditional approaches like formalin-inactivated viruses (which produced poor humoral responses in animal models), VLPs offer better immunogenicity and safety profiles. More recent vaccine design strategies have also focused on developing antibody-driven complexes targeting neutralizing viral antigens .

What are the cross-reactive immunological properties between HMPV F and RSV F?

HMPV F and RSV F share significant structural similarities, particularly in their post-fusion conformations, which leads to interesting cross-reactive immunological properties:

  • Structural basis for cross-reactivity: High similarity exists between HMPV and RSV post-fusion F in at least two antigenic sites targeted by neutralizing antibodies .

  • Cross-protection potential: Antibodies raised against one virus might offer some protection against the other, though the extent varies.

  • Strain cross-protection: Studies on human serum samples have suggested the potential existence of cross-protection between HMPV A1 and B1 strains, indicating broadly neutralizing epitopes .

  • Differential immunogenicity of viral proteins: For both viruses, the F protein demonstrates stronger immunogenicity compared to the G protein, with significantly higher antibody titers detected against F protein than against G protein in human serum samples .

This cross-reactivity has implications for vaccine design, potentially allowing for the development of vaccines that provide protection against both respiratory pathogens.

How does the structure of HMPV F compare to other paramyxovirus fusion proteins?

The HMPV F protein shares structural features with other paramyxovirus fusion proteins but also displays distinct characteristics:

  • Similarity to RSV F: HMPV F post-fusion structure closely resembles that of RSV F, appearing as an elongated cone. Both proteins belong to the Pneumovirus subfamily and share high structural similarity .

  • Differences from other paramyxoviruses: Significant structural differences exist between HMPV F and fusion proteins from other paramyxoviruses like human parainfluenza virus type 3 (hPIV3) and Newcastle disease virus (NDV) .

  • Conserved functional domains: Despite structural differences, all paramyxovirus F proteins contain conserved functional elements including a hydrophobic fusion peptide, heptad repeat regions (HRA and HRB), and a transmembrane domain.

  • Conformational states: Like other paramyxovirus F proteins, HMPV F exists in both pre-fusion and post-fusion conformations, though the stability and triggering mechanisms may differ .

These structural comparisons provide insights into the evolution and functional adaptations of fusion proteins across the paramyxovirus family.

What structural features of HMPV F are conserved across different virus strains and subtypes?

Several structural features of HMPV F are highly conserved across different virus strains and subtypes:

  • F1 domain: The F1 subunit contains highly conserved regions across all HMPV subtypes, making it an attractive target for broad-spectrum therapeutics and vaccines .

  • Fusion machinery: The core machinery required for membrane fusion, including the fusion peptide and heptad repeat regions, shows high conservation.

  • Neutralizing epitopes: Certain epitopes targeted by neutralizing antibodies are conserved across HMPV strains, suggesting potential for broad protection through vaccination .

  • Glycosylation sites: N-linked glycosylation sites at positions Asn70 and Asn500 are conserved, with these modifications playing important roles in protein folding and immune evasion .

  • Cysteine residues: Disulfide bonds formed by conserved cysteine residues (such as Cys322 and Cys333) maintain structural integrity of the protein .

This high conservation in key structural regions explains why F protein-targeted vaccines might potentially provide protection against multiple HMPV strains.

What are the molecular determinants of HMPV F protein fusion triggering in the absence of an attachment protein?

Understanding how HMPV F is triggered to undergo conformational changes without a separate attachment protein remains an important research question. Current hypotheses and research directions include:

  • Direct receptor binding: HMPV F might directly interact with cellular receptors like integrins to trigger fusion, with specific structural motifs in F mediating these interactions .

  • Environmental triggering factors: Investigation of pH, temperature, or protease activity as potential triggering factors that may induce conformational changes in HMPV F.

  • Structural elements governing metastability: Identification of specific regions in the pre-fusion conformation that regulate the stability threshold and control triggering sensitivity.

  • Comparison with RSV F: Comparative studies with RSV F, which also functions without an attachment protein, may reveal conserved triggering mechanisms unique to pneumoviruses.

Resolving this question would provide fundamental insights into viral entry mechanisms and potentially identify new targets for antiviral development.

How can structure-based design be optimized to create stable pre-fusion HMPV F immunogens for vaccine development?

Structure-based design of stable pre-fusion HMPV F immunogens represents a cutting-edge approach to vaccine development:

  • Stabilizing mutations: Identification of key residues that, when mutated, can lock F in its pre-fusion conformation without compromising critical neutralizing epitopes.

  • Computational design: Employment of computational methods to predict stabilizing modifications based on energy calculations and molecular dynamics simulations.

  • Epitope-focused design: Engineering immunogens that present the most potent neutralizing epitopes in optimal conformations while minimizing presentation of non-neutralizing epitopes.

  • Novel display platforms: Development of nanoparticle or virus-like particle platforms that present multiple copies of stabilized F proteins in favorable orientations for immune recognition.

  • Rational adjuvant pairing: Identification of adjuvants that specifically enhance immune responses to critical neutralizing epitopes without promoting unfavorable immune profiles.

Success in this area could lead to a breakthrough HMPV vaccine with enhanced efficacy compared to traditional approaches.

What are the molecular mechanisms of antibody-mediated neutralization of HMPV, and how do they differ between antibodies targeting various epitopes?

Understanding the precise mechanisms of antibody-mediated neutralization remains a sophisticated research question:

  • Fusion inhibition mechanisms: Different antibodies may block fusion through various mechanisms, including:

    • Preventing initial receptor attachment

    • Stabilizing the pre-fusion conformation to prevent triggering

    • Interfering with conformational changes during the fusion process

    • Blocking membrane insertion of the fusion peptide

  • Epitope-specific effects: Antibodies targeting different epitopes on HMPV F may exhibit varying neutralization potencies and mechanisms:

    • DS7-like antibodies bind structurally invariant domains and may neutralize by mechanisms that work against both pre- and post-fusion forms

    • Pre-fusion-specific antibodies likely prevent the conformational changes required for fusion

    • Quaternary epitope-targeting antibodies may cross-link protomers and prevent necessary rearrangements

  • Fc-mediated effects: Investigation of whether antibody effector functions beyond direct neutralization (e.g., antibody-dependent cellular cytotoxicity, complement activation) contribute to protection against HMPV.

  • Structural basis of potency: Correlation of structural binding characteristics (affinity, epitope location, angle of approach) with neutralizing potency to guide rational vaccine design.

Resolving these questions will enhance our understanding of protective immunity against HMPV and inform next-generation vaccine and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.