Recombinant Human metapneumovirus Major surface glycoprotein G (G)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Metapneumovirus Glycoprotein G (G)

Recombinant human metapneumovirus (hMPV) glycoprotein G (G) is a genetically engineered form of the virus’s primary surface glycoprotein, produced via expression systems such as mammalian cells or Escherichia coli. This protein plays critical roles in viral attachment to host cells and immune modulation, though its structural and functional properties diverge significantly from other paramyxovirus attachment proteins. Unlike the fusion (F) glycoprotein, which mediates membrane fusion, G lacks hemagglutinin/neuraminidase activity and instead interacts with host glycosaminoglycans (GAGs) to facilitate initial attachment .

Immunogenicity and Protective Efficacy

Vaccine Candidate Limitations

  • Lack of Neutralizing Antibodies: Immunization with recombinant GΔTM in cotton rats induced high titers of non-neutralizing antibodies but failed to confer protection against viral challenge .

  • Comparative Studies: Unlike attachment proteins in other paramyxoviruses (e.g., measles or respiratory syncytial virus), hMPV G is not a protective antigen .

Viral StrainReplication (Nasal Turbinates)Replication (Lungs)Clinical Disease
Wild-type (WT)High titer (e.g., 6.4 log TCID50/g)High titer (e.g., 5.0 log TCID50/g)Severe AHR, obstruction
ΔGReduced titer (e.g., 2.2 log TCID50/g)Reduced titer (e.g., 2.5 log TCID50/g)Mild or absent symptoms

Data adapted from studies comparing WT and ΔG hMPV in animal models .

Research Findings and Implications

Immune Modulation

  • Innate Immunity: G suppresses RIG-I signaling, reducing IFN-α/β and chemokine production, which compromises early antiviral responses .

  • Adaptive Immunity: ΔG infection in mice recruits activated T cells, dendritic cells, and B cells, suggesting G dampens adaptive immune activation .

Diagnostic and Therapeutic Potential

  • Serological Testing: Recombinant G is less sensitive for diagnosing hMPV compared to matrix (M) or nucleocapsid (N) proteins, as shown by lower seroprevalence in ELISAs .

  • Vaccine Design: While G itself is not protective, its deletion in ΔG viruses highlights its role in pathogenesis. Future vaccines may target F or combine multiple antigens (e.g., F + N) for broader immunity .

Key Challenges and Future Directions

  • Structural Complexity: The disordered, glycosylated nature of G complicates its use as a vaccine antigen. Stabilized forms or chimeric proteins may be required for effective immunization .

  • Strain Variability: G exhibits low sequence conservation across hMPV lineages, necessitating multivalent vaccine strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notice and additional fees apply for dry ice shipment.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
G; Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Human metapneumovirus (strain CAN97-83) (HMPV)
Target Names
G
Target Protein Sequence
MEVKVENIRAIDMLKARVKNRVARSKCFKNASLILIGITTLSIALNIYLIINYTIQKTSS ESEHHTSSPPTESNKEASTISTDNPDINPNSQHPTQQSTENPTLNPAASVSPSETEPAST PDTTNRLSSVDRSTAQPSESRTKTKPTVHTRNNPSTASSTQSPPRATTKAIRRATTFRMS STGKRPTTTSVQSDSSTTTQNHEETGSANPQASVSTMQN
Uniprot No.

Target Background

Function

Glycoprotein G mediates virion attachment to the host cell membrane via interaction with glycosaminoglycans, initiating infection. Unlike other paramyxovirus attachment proteins, it lacks neuraminidase and hemagglutinating activities. Beyond attachment, glycoprotein G interacts with host DDX58, inhibiting DDX58-mediated signaling to prevent the antiviral response.

Database Links

KEGG: vg:2799942

Protein Families
Metapneumoviruses glycoprotein G family
Subcellular Location
Host membrane; Single-pass type I membrane protein. Virion.

Q&A

What is Human Metapneumovirus glycoprotein G and what is its role in viral pathogenesis?

Human metapneumovirus glycoprotein G is a type II mucin-like glycosylated protein that serves as one of the major surface proteins of hMPV. While initially postulated to function in viral attachment to target cells, research has demonstrated that G protein plays a more significant role as a virulence factor by modulating host immune responses .

Unlike other paramyxoviruses, the F protein of hMPV alone is sufficient to mediate attachment and fusion in the absence of other surface proteins, including G . The interaction of F with cellular integrin receptors occurs independently of G protein . Studies using recombinant viruses lacking G protein (rhMPV-ΔG) have revealed that while G is not essential for viral entry and replication in vitro, it significantly contributes to viral pathogenesis in vivo by inhibiting innate immune signaling .

What is the structural composition of hMPV glycoprotein G?

hMPV glycoprotein G is structurally characterized as:

  • A type II membrane-anchored glycoprotein with an N-terminal intracellular domain and C-terminus oriented externally

  • Smaller than the G protein of RSV (236 amino acids versus 299 amino acids)

  • Containing a relatively short intracellular amino-terminal cytoplasmic domain (~30 amino acids) adjacent to a hydrophobic transmembrane domain

  • Heavily glycosylated with both O- and N-linked sugars, similar to RSV G protein

  • Forming multimeric structures when expressed in native form, as demonstrated by native gel electrophoresis

The predicted molecular weight of soluble recombinant G ectodomain (GΔTM) based on primary amino acid sequence is approximately 25 kD, but the mature glycosylated protein migrates at approximately 75 kD on SDS-PAGE under reducing conditions, reflecting extensive post-translational modifications .

How do researchers produce recombinant hMPV G protein for experimental studies?

Production of recombinant hMPV G protein involves several methodological approaches:

  • Cloning of the G gene sequence from clinical isolates using RT-PCR with specific primers targeting the G region

  • Sequence optimization for mammalian expression by:

    • Altering suboptimal codon usage for mammalian tRNA bias

    • Improving secondary mRNA structure

    • Removing AT-rich regions to increase mRNA stability

  • Creation of expression constructs:

    • For full-length G protein: Cloning into mammalian expression vectors such as pcDNA3.1

    • For soluble G ectodomain (GΔTM): Removing the transmembrane domain and cytoplasmic tail, adding an N-terminal hexahistidine tag, and incorporating an Ig-κ leader sequence for efficient secretion

  • Expression in mammalian cell lines such as 293-F cells, with typical yields of 0.2-0.5 mg/30 ml of culture medium

  • Purification via affinity chromatography using the hexahistidine tag

This approach allows for production of properly glycosylated, native-like G protein for immunological and functional studies .

How does genetic variability affect hMPV G protein function and research applications?

The G gene of hMPV displays significant strain-to-strain variability, similar to the G gene of RSV . Key aspects of this variability include:

This genetic diversity significantly impacts research applications by:

  • Necessitating careful selection of representative strains for studies

  • Requiring consideration of cross-reactivity of antibodies and immunological reagents

  • Creating challenges for development of universal vaccines targeting G protein

  • Suggesting potential immune selection pressure, although functional T cell epitopes have not been identified in hMPV G

What molecular mechanisms does hMPV G protein employ to inhibit host innate immune responses?

hMPV G protein functions as a major inhibitory factor of host antiviral responses through multiple specific molecular mechanisms:

  • Inhibition of RIG-I-dependent signaling: G protein directly associates with retinoic acid-inducible gene I (RIG-I), a critical intracellular viral RNA sensor, inhibiting RIG-I-dependent gene transcription .

  • Blocking MAVS activation: G protein targets mitochondrial antiviral-signaling protein (MAVS) activation downstream of RIG-I, interfering with the signaling cascade leading to interferon production .

  • Suppression of transcription factor activation: G protein inhibits activation of:

    • NF-κB family transcription factors

    • Interferon regulatory factor (IRF) family proteins
      This is evidenced by decreased nuclear translocation and phosphorylation of these factors in cells infected with wild-type hMPV compared to G-deleted virus .

  • Inhibition of TLR-4-dependent signaling: In monocyte-derived dendritic cells, G protein targets Toll-like receptor 4 (TLR-4)-dependent signaling and hMPV internalization, affecting CD4+ T cell activation .

  • Reduction of chemokine and interferon production: Airway epithelial cells infected with rhMPV-ΔG produce significantly higher levels of chemokines and type I interferons compared to cells infected with rhMPV-WT, demonstrating G protein's suppressive effect on these immune mediators .

These mechanisms collectively contribute to immune evasion and enhanced pathogenesis during hMPV infection .

How does deletion of G protein affect viral replication and pathogenesis in experimental animal models?

Deletion of G protein from hMPV creates a distinctly attenuated phenotype in animal models with multiple immunological and pathological consequences:

Viral replication:

  • rhMPV-ΔG exhibits reduced replication in the upper and lower respiratory tract of Syrian hamsters and African green monkeys

  • In mouse models, rhMPV-ΔG replication in the lung is at the lowest levels of detection by TCID₅₀ assays

Disease manifestation:

  • rhMPV-ΔG is strongly attenuated and does not induce significant clinical disease

  • Animals infected with rhMPV-ΔG show minimal airway obstruction and airway hyperresponsiveness (AHR) compared to rhMPV-WT infection

Cellular immune responses:

  • rhMPV-ΔG infection is associated with a distinct phenotype of cellular immune response characterized by:

    • Increased recruitment of dendritic cells, natural killer cells, and B cells

    • Enhanced presence of activated T cells compared to rhMPV-WT infection

    • Altered neutrophil recruitment patterns

Cytokine production:

  • G protein deletion results in modified cytokine production profiles in the lungs of infected animals

  • BAL fluid from rhMPV-ΔG infected animals shows distinct cytokine patterns compared to rhMPV-WT infected animals

Protection against challenge:

These findings collectively demonstrate that G protein is an important virulence factor contributing to airway disease and modulation of immune responses during hMPV infection .

What is the potential of rhMPV-ΔG as a vaccine candidate and what challenges exist?

Recombinant hMPV lacking G protein (rhMPV-ΔG) has several characteristics that make it a promising vaccine candidate, along with certain challenges:

Favorable characteristics:

  • Strong attenuation in animal models with minimal clinical disease and airway dysfunction

  • Enhanced innate immune activation compared to wild-type virus

  • Ability to induce neutralizing antibodies despite attenuated replication

  • Protection against challenge with wild-type hMPV in animal models

  • Increased recruitment of dendritic cells, NK cells, and B cells that may enhance adaptive immunity

Challenges and concerns:

  • Enhanced early disease manifestation upon challenge: Mice previously infected with rhMPV-ΔG showed some signs of enhanced lung disease at early time points after challenge compared to those previously infected with wild-type virus

  • Very low replication levels may limit robust immune stimulation in some cases

  • Potential for strain-specific protection given the genetic variability between hMPV subtypes

  • Lack of comprehensive understanding of correlates of protection against hMPV infection

Research needs:

  • Further exploration of the mechanism behind the enhanced early disease upon challenge in rhMPV-ΔG vaccinated animals

  • Evaluation in additional animal models and eventually human clinical trials

  • Assessment of cross-protection against multiple hMPV genotypes

  • Determination of optimal dosing and administration routes to balance attenuation with immunogenicity

Despite challenges, rhMPV-ΔG represents a promising vaccine platform for hMPV, with its attenuated phenotype and ability to induce protective immunity making it worthy of continued investigation .

Why does recombinant G protein induce antibodies that are neither neutralizing nor protective?

The phenomenon of hMPV G protein inducing non-neutralizing, non-protective antibodies represents an unusual feature among paramyxoviruses and has several potential explanations:

Experimental evidence:

Potential mechanisms:

  • Extensive glycosylation: The heavy glycosylation of G protein may contribute to immune avoidance, potentially shielding key epitopes or altering protein conformation in ways that prevent neutralizing antibody development

  • Non-essential role in attachment: Unlike other paramyxoviruses, hMPV F protein alone is sufficient for attachment and fusion, making G protein less critical as a target for neutralizing antibodies

  • Conformational differences: Recombinant soluble G protein may not precisely mimic the native conformation of G on the viral surface, potentially exposing non-neutralizing epitopes while masking potential neutralizing ones

  • Multimeric structure: Native G protein forms multimers, and the recombinant form also demonstrates multimeric structure. This complex arrangement may affect epitope presentation and antibody accessibility

This unique characteristic of hMPV G protein raises fundamental questions about its biological function and evolutionary purpose, as it is nonessential for replication but contributes to disease pathogenesis, possibly through its immunomodulatory properties rather than attachment functions .

What methodological approaches can be used to assess the functional role of G protein in modulating hMPV-induced immune responses?

Researchers employ diverse methodological approaches to characterize the immunomodulatory functions of hMPV G protein:

Reverse genetics systems:

  • Generation of recombinant viruses with deletion or mutation of G protein (rhMPV-ΔG)

  • Creation of chimeric viruses expressing G proteins from different strains or genotypes

In vitro cellular models:

  • Airway epithelial cell infection models to assess chemokine and interferon production

  • Dendritic cell cultures to evaluate antigen presentation and T cell activation

  • Transcription factor activation assays measuring nuclear translocation and phosphorylation of NF-κB and IRF family proteins

Protein-protein interaction studies:

  • Co-immunoprecipitation assays to identify binding partners like RIG-I

  • Reporter gene assays to assess inhibition of RIG-I-dependent gene transcription

  • Confocal microscopy to visualize co-localization with cellular components

Animal models:

  • Infection of mice, cotton rats, hamsters, or non-human primates with wild-type and G-deleted viruses

  • Assessment of clinical disease parameters including body weight loss and respiratory function

  • Analysis of bronchoalveolar lavage (BAL) fluid for cellular composition and cytokine levels

  • Flow cytometric analysis of lung immune cell populations

  • Challenge studies to evaluate protective immunity

Immunological assays:

  • Neutralization assays using sera from immunized animals or infected patients

  • ELISA to measure antibody responses to native and recombinant G protein

  • Cytokine and chemokine profiling using multiplex assays (Bio-Plex) or ELISA

These complementary approaches allow researchers to comprehensively characterize the complex immunomodulatory functions of hMPV G protein at molecular, cellular, and organismal levels .

How can researchers optimize the microneutralization assay for evaluating anti-hMPV antibodies?

The microneutralization assay is a critical tool for evaluating antibody responses to hMPV vaccines and infections. Researchers can optimize this assay through several methodological considerations:

Cell density optimization:

  • Standard cell concentration (2.0 × 10⁵ cell ml⁻¹) produces reliable results, but optimization between 1.5-2.5 × 10⁵ cell ml⁻¹ may be necessary depending on cell type and growth characteristics

  • Consistency in cell seeding density is crucial for reproducible results, with geometric coefficient of variation (GCV) values of 25.32% for hMPV-A1 and 36.62% for hMPV-B1 being acceptable

Virus-serum incubation parameters:

  • Standard incubation time of 60 minutes for serum-virus mixtures before transfer to cell monolayers is typical

  • Variations of ±15 minutes (45-75 minutes) show acceptable robustness with GCV values of 24.04% for hMPV-A1 and 29.85% for hMPV-B1

  • Temperature control during incubation is essential for consistent neutralization kinetics

Assay controls and standardization:

  • Inclusion of positive and negative control sera is critical

  • Multiple replicates (typically 4 per condition) help ensure statistical reliability

  • Testing by multiple operators validates reproducibility of the assay

Virus strain considerations:

  • Due to genetic variability between hMPV subtypes, neutralization assays should ideally test against representative strains from different genetic lineages (A1, A2, B1, B2)

  • Cross-neutralization between subtypes should be assessed to understand breadth of protection

Result interpretation:

  • Semi-quantitative microneutralization assays provide relative potency (RP) values rather than absolute titers

  • Acceptance criteria typically set at GCV ≤ 45% ensure reliable and reproducible results

By optimizing these parameters, researchers can develop robust microneutralization assays for evaluating antibody responses to hMPV, supporting both fundamental research and vaccine development efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.