Recombinant Human Microsomal glutathione S-transferase 1 (MGST1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Microsomal Glutathione S-transferase 1 (MGST1)

Recombinant Human Microsomal Glutathione S-transferase 1 (MGST1) is a protein encoded by the MGST1 gene in humans. It belongs to the MAPEG family, which includes membrane-associated proteins involved in eicosanoid and glutathione metabolism . MGST1 is known for its role in cellular defense against oxidative stress and toxic compounds by catalyzing the conjugation of glutathione to electrophiles and reducing lipid hydroperoxides .

Structure and Function

MGST1 is a homotrimer that can bind three molecules of glutathione (GSH), with one modified to a thiolate anion, displaying one-third-of-sites-reactivity . It exhibits both glutathione transferase and peroxidase activities, which are crucial for protecting cells from oxidative damage . MGST1 is predominantly localized in the endoplasmic reticulum and outer mitochondrial membrane, where it plays a significant role in safeguarding these membranes from lipid peroxidation .

Role in Cancer

Recent studies have highlighted the involvement of MGST1 in cancer progression. Elevated MGST1 expression is associated with poor prognosis in various cancers, including uterine corpus endometrial carcinoma (UCEC) and gastric cancer (GC) . In UCEC, high MGST1 expression correlates with reduced immune cell infiltration and poor survival outcomes . In GC, MGST1 promotes cell proliferation and inhibits ferroptosis, contributing to tumor development .

Biological Functions and Research Findings

MGST1 is essential for cellular protection against oxidative stress and has been implicated in hematopoiesis. Deletion of MGST1 in mice is embryonic lethal, underscoring its critical role in development . In cancer, MGST1's ability to inhibit ferroptosis and enhance cell survival makes it a potential therapeutic target .

Table 1: MGST1 Expression and Cancer Prognosis

Cancer TypeMGST1 ExpressionPrognosis
UCECElevatedPoor
Gastric Cancer (GC)UpregulatedPoor

Table 2: MGST1 Functions and Activities

Function/ActivityDescription
Glutathione TransferaseConjugates glutathione to electrophiles
Peroxidase ActivityReduces lipid hydroperoxides
Cellular ProtectionSafeguards against oxidative stress

References High expression of the ferroptosis‐associated MGST1 gene in UCEC. Microsomal glutathione transferase 1 in cancer and the regulation of ferroptosis. MGST1 Expression Is Associated with Poor Prognosis, Enhancing Cancer Development in Gastric Cancer. Microsomal glutathione S-transferase 1 - Wikipedia. Sequence-based Association Analysis Reveals an MGST1 eQTL. Microsomal Glutathione Transferase 1 Protects Against Toxicity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MGST1; GST12; MGST; Microsomal glutathione S-transferase 1; Microsomal GST-1; Microsomal GST-I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-155
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MGST1
Target Protein Sequence
VDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAKK YLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAY LTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
Uniprot No.

Target Background

Function
Conjugates reduced glutathione to a wide range of exogenous and endogenous hydrophobic electrophiles. Exhibits broad substrate specificity.
Gene References Into Functions
  1. High MGST1 expression correlates with bendamustine resistance in mantle cell lymphoma. PMID: 29695404
  2. A significant association was observed between germline variations in the COX pathway (specifically the MGST1 gene) and the risk of Barrett's esophagus and combined Barrett's esophagus and esophageal adenocarcinoma. PMID: 29713984
  3. This study comprehensively evaluates inflammation-related germline variations and their association with BE/OA risk, suggesting that MGST1 variants influence disease susceptibility. PMID: 27486097
  4. MGST1 exists in a dynamic equilibrium between high- and low-activity forms. PMID: 28558199
  5. While studies using NB cells suggest potential variations in NB mitochondrial homeostasis, these findings may not be directly applicable to other tumor and cell types exhibiting high MGST1 expression. PMID: 24486338
  6. Differential expression of SOD2, ALDH1A1, and MGST1 genes in anterior lens capsules of patients with pseudoexfoliation syndrome suggests a response to reported oxidative stress in diseased tissue. PMID: 23805041
  7. MGST1 gene polymorphisms may contribute to colorectal cancer risk in younger individuals. PMID: 23314968
  8. MGST1 protects cells (and mitochondria) through both conjugation and glutathione peroxidase functions, suggesting a novel protective mechanism against cisplatin. PMID: 20727966
  9. Polymorphisms in microsomal glutathione S-transferase are associated with laryngeal cancer. PMID: 12359356
  10. Sp1 mediates the basal transcription of MGST1. PMID: 12818425
  11. Genes encoding KU70, MGST1, and BIK exhibit age-related mRNA expression levels in hematopoietic stem cells. PMID: 17714764
  12. A SNP map of the MGST1 gene is provided, complementing existing high-density SNP maps of 12 glutathione S-transferase and related genes. PMID: 11587073
Database Links

HGNC: 7061

OMIM: 138330

KEGG: hsa:4257

STRING: 9606.ENSP00000010404

UniGene: Hs.389700

Protein Families
MAPEG family
Subcellular Location
Microsome. Mitochondrion outer membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in liver.

Q&A

What is the structural organization of MGST1?

MGST1 is a homotrimeric membrane protein with a molecular weight of approximately 51 kDa. Each functional unit consists of three identical subunits centered on crystallographic three-fold axes. The protein exhibits a distinctive left-handed four-helix bundle motif within the membrane, as determined by electron crystallography at 6 Å resolution . This structure differs significantly from soluble glutathione transferases despite overlapping substrate specificity. The four-helix bundle creates a membrane topology where the N- and C-termini are positioned on the lumenal side of the membrane, while the active site faces the cytoplasm .

How does MGST1 bind and interact with glutathione (GSH)?

MGST1 binds GSH in an extended conformation at the interface between two subunits of the trimer. The binding occurs substoichiometrically, with evidence suggesting only one GSH molecule binds per trimeric enzyme complex . Arginine 130 plays a critical role in stabilizing the strongly nucleophilic GSH thiolate required for catalysis, as mutation of this residue to alanine results in complete loss of activity . The GSH-binding process involves a two-step mechanism: rapid formation of an initial pre-complex (EGSH) followed by slow deprotonation of GSH to form the final complex (EGS-, with a rate constant of approximately 0.4 s⁻¹) .

What are the primary catalytic functions of MGST1?

MGST1 catalyzes two main reactions:

  • Glutathione S-transferase (GST) activity: Conjugation of GSH to a wide variety of electrophilic compounds including halogenated alkenes and arenes, alpha,beta-unsaturated hydrocarbons, and other xenobiotics .

  • Glutathione peroxidase activity: Reduction of organic hydroperoxides, protecting cellular membranes from oxidative damage .

The efficiency of conjugation increases with more reactive substrates. When using 1-chloro-2,4-dinitrobenzene (CDNB) as a substrate and pre-charging MGST1 with GSH, a burst of product formation occurs with a rate constant of approximately 500 s⁻¹ for the chemical step .

What mechanisms underlie the activation of MGST1 and how can this be experimentally analyzed?

MGST1 can be activated up to 30-fold through various chemical treatments, particularly those targeting the unique cysteine-49 residue with sulfhydryl reagents . This activation substantially increases catalytic activity toward reactive substrates like CDNB. The mechanistic basis for activation has been identified as enhancement of the GSH deprotonation step—the rate constant increases from approximately 0.4 s⁻¹ in the non-activated enzyme to 3.6 s⁻¹ in the N-ethylmaleimide activated form .

For experimental analysis of activation mechanisms:

  • Targeted mutagenesis of Cys-49 can be performed to evaluate its role in activation.

  • Measure reaction kinetics with varying concentrations of activating agents using stopped-flow techniques.

  • Compare rate constants for GSH deprotonation and substrate conjugation between activated and non-activated forms.

  • Investigate the hydrophobic environment of Cys-49 using environmentally sensitive probes, as evidence suggests this residue resides in a hydrophobic milieu with preference for reaction with hydrophobic electrophiles .

How can researchers differentiate between the binding sites and catalytic mechanisms of MGST1 compared to cytosolic GSTs?

Despite functional similarities, MGST1 displays a fundamentally different tertiary structure compared to cytosolic GSTs . Key experimental approaches to differentiate these enzymes include:

  • Structural analysis: Electron crystallography of MGST1 reveals a left-handed four-helix bundle motif that is absent in cytosolic GSTs, which can be visualized using electron microscopy techniques of two-dimensional crystals .

  • Active site comparison: While cytosolic GSTs have independent active sites in each 25 kDa subunit, MGST1 appears to form one active site within the homotrimer. This can be determined through site-directed mutagenesis of putative active site residues in different subunits and analyzing the impact on catalytic activity .

  • Substrate specificity profiling: Compare reaction rates and binding affinities for a panel of substrates between MGST1 and cytosolic GSTs to identify differentiating characteristics.

  • Membrane association studies: Unlike cytosolic GSTs, MGST1 is membrane-bound with its active site facing the cytoplasm. Membrane topology can be analyzed using protease protection assays and selective labeling techniques .

What experimental approaches can be used to investigate the apparent subunit cooperativity in MGST1?

The substoichiometric binding of GSH (one molecule per trimer) suggests subunit cooperativity in MGST1 . To investigate this phenomenon:

  • Equilibrium binding studies: Using isothermal titration calorimetry or fluorescent GSH analogs to determine binding stoichiometry and affinity constants.

  • Cross-linking experiments: Chemical cross-linking between subunits followed by mass spectrometry analysis to identify intersubunit interactions that may regulate cooperativity.

  • Creation of hetero-oligomers: Generate fusion proteins where specific subunits carry mutations in key residues to determine if all three subunits contribute equally to the single active site.

  • Single-molecule kinetic studies: Measure the kinetics of substrate turnover with single-enzyme resolution to detect potential allosteric effects between subunits.

  • Fluorescence resonance energy transfer (FRET): Detect conformational changes between subunits upon substrate binding using specifically labeled recombinant proteins.

What are the optimal expression systems and purification strategies for producing recombinant MGST1?

MGST1, being a membrane protein, presents challenges for recombinant expression. Several systems have been employed successfully:

  • Wheat germ cell-free expression system: This in vitro system helps preserve correct conformational folding necessary for biological function, though activity validation may be required .

  • Bacterial expression systems: E. coli-based expression with specific membrane protein-friendly strains (C41/C43) and appropriate detergents for solubilization.

  • Insect cell expression: Baculovirus-mediated expression in Sf9 or Hi5 cells can maintain proper folding and post-translational modifications.

Purification strategies typically involve:

  • Membrane preparation by differential centrifugation

  • Solubilization with appropriate detergents (e.g., Triton X-100)

  • Affinity chromatography (GSH-agarose or metal affinity for tagged proteins)

  • Size exclusion chromatography for final polishing

The purified protein should be stored in 50 mM Tris-HCl buffer with 10 mM reduced glutathione at pH 8.0 to maintain stability, and storage at -80°C with minimal freeze-thaw cycles is recommended .

How can researchers accurately measure and distinguish the GST versus peroxidase activities of MGST1?

MGST1 exhibits dual catalytic functions that require different experimental approaches:

For GST activity:

  • Spectrophotometric assay with CDNB: Monitor the formation of the GSH-CDNB conjugate at 340 nm (ε = 9.6 mM⁻¹cm⁻¹).

  • Fluorogenic substrates: 6-bromoacetyl-2-N,N-dimethylaminonaphthalene or preferably its chloro-analog, which has been shown to be a more sensitive substrate for MGST1 .

  • HPLC-based assays for substrates without convenient spectroscopic properties.

For peroxidase activity:

  • Coupled assay with glutathione reductase: Monitor NADPH oxidation at 340 nm.

  • Direct measurement of hydroperoxide consumption using ferrous oxidation-xylenol orange (FOX) assay.

  • Specific assays for phospholipid hydroperoxides if investigating membrane-embedded substrates.

To distinguish between these activities:

  • Use selective inhibitors that preferentially affect one activity over the other.

  • Compare kinetic parameters (kcat and Km) for different substrate classes.

  • Perform site-directed mutagenesis targeting residues predicted to be involved in each activity.

What techniques can be used to investigate the lipid-MGST1 interactions that affect enzyme function?

As a membrane protein, MGST1's function is intimately tied to its lipid environment. Several approaches can be used to study these interactions:

  • Reconstitution studies: Purified MGST1 can be reconstituted into liposomes of defined lipid composition to assess how different phospholipids affect activity.

  • Native mass spectrometry: This technique can identify specific lipids that remain bound to the protein during purification, indicating tight associations.

  • Electron crystallography: This method has revealed structured phospholipid molecules associated with MGST1, providing insight into specific lipid binding sites .

  • Fluorescence anisotropy: Measuring the rotational diffusion of fluorescently labeled MGST1 in different membrane environments can provide information about protein-lipid interactions.

  • Atomic force microscopy: This can be used to visualize MGST1 organization in membrane patches and detect lipid-dependent clustering.

  • Molecular dynamics simulations: In silico approaches can model how MGST1 interacts with surrounding lipids and how these interactions might influence protein dynamics and substrate access.

How is MGST1 implicated in cancer biology and what are the methodological approaches to study this relationship?

MGST1 has been found to be overexpressed in certain cancers, including uterine corpus endometrial carcinoma (UCEC), and this overexpression correlates with poor prognosis . Researchers can investigate this relationship using several approaches:

  • Expression analysis: Compare MGST1 mRNA and protein levels between tumor and normal tissues using quantitative PCR, western blotting, and immunohistochemistry.

  • Survival correlation: Perform Kaplan-Meier analysis to correlate MGST1 expression levels with patient outcomes, as elevated expression has been linked to poor survival time in UCEC .

  • Protein-protein interaction studies: Investigate MGST1's interaction with ferroptosis-related proteins, which has been established through computational approaches and could be validated experimentally through co-immunoprecipitation or proximity ligation assays .

  • Immune cell infiltration analysis: MGST1 overexpression has been associated with altered immune cell infiltration patterns in UCEC, including lower levels of NK cells and CD8+ T cells and higher levels of myeloid-derived suppressor cells . Flow cytometry or immunohistochemistry can be used to analyze these patterns in relation to MGST1 expression.

  • Epigenetic regulation: Investigate hypermethylation and low promoter methylation patterns that cooperate to regulate MGST1 expression in cancer, using bisulfite sequencing or methylation-specific PCR .

What experimental designs can effectively assess MGST1's role in cellular detoxification and protection against oxidative stress?

To evaluate MGST1's protective functions:

  • Gene knockdown/knockout studies: Use siRNA, CRISPR-Cas9, or antisense oligonucleotides to reduce or eliminate MGST1 expression, then challenge cells with various toxins or oxidative stressors to assess vulnerability.

  • Overexpression studies: Create stable cell lines overexpressing wild-type or mutant MGST1 to evaluate enhanced protection against specific toxins.

  • Measurement of reactive oxygen species (ROS): Use fluorescent probes (e.g., DCFDA, CellROX) to quantify ROS levels in cells with modified MGST1 expression after toxin exposure.

  • Cell viability assays: Compare survival rates of cells with different MGST1 expression levels when exposed to graduated concentrations of various electrophilic compounds and peroxides.

  • Metabolite profiling: Use mass spectrometry to identify and quantify GSH conjugates formed in cells, providing direct evidence of MGST1-mediated detoxification.

  • Lipid peroxidation analysis: Measure products like malondialdehyde or 4-hydroxynonenal to assess MGST1's ability to protect membrane lipids from peroxidation.

  • In vivo models: Generate transgenic mice with altered MGST1 expression to study detoxification and protection at the organismal level.

What are the common challenges in working with recombinant MGST1 and how can they be addressed?

Working with MGST1 presents several technical challenges:

  • Membrane protein solubility: MGST1's hydrophobic nature can lead to aggregation during expression and purification.

    • Solution: Optimize detergent selection and concentration; consider using mild detergents like n-dodecyl-β-D-maltoside or digitonin.

  • Maintaining native trimeric structure: Harsh solubilization conditions can disrupt the functional trimeric assembly.

    • Solution: Use native PAGE or analytical ultracentrifugation to confirm trimeric state after purification.

  • Activity loss during purification: The enzyme may lose activity due to detergent effects or loss of essential lipids.

    • Solution: Add exogenous lipids during purification or reconstitute purified protein in liposomes to restore activity.

  • Variability in activation state: Different purification batches may have varying levels of activation.

    • Solution: Standardize activation protocols using N-ethylmaleimide or other activators; alternatively, develop methods to achieve a consistent basal state.

  • Substrate solubility: Many MGST1 substrates are hydrophobic and have limited aqueous solubility.

    • Solution: Use appropriate co-solvents (ethanol, DMSO) at concentrations that don't interfere with enzyme activity; develop microsomal or liposomal assay systems.

  • Expression yield: Low yield of functional protein is common with membrane proteins.

    • Solution: Consider using wheat germ cell-free expression systems that have shown success with MGST1 , or optimize codon usage for the expression host.

How can researchers resolve discrepancies in MGST1 activity data across different experimental systems?

When facing inconsistent MGST1 activity data:

  • Standardize assay conditions: Ensure buffer composition, pH, temperature, and substrate concentrations are consistent across experiments.

  • Account for membrane composition: Different expression systems yield MGST1 in different membrane environments, affecting activity. Reconstitution in defined liposomes can normalize these differences.

  • Consider activation state: MGST1 activity can vary 30-fold depending on activation . Document and control the activation state of the enzyme preparation.

  • Validate protein quality: Assess protein purity, oligomeric state, and structural integrity using SDS-PAGE, native PAGE, and circular dichroism.

  • Normalize activity data: Express activity per unit of active enzyme rather than total protein, possibly using active site titration methods.

  • Account for substrate partitioning: In membrane systems, hydrophobic substrates partition between the aqueous phase and membranes. Calculate effective substrate concentrations in the membrane phase.

  • Cross-validate with multiple substrates: Test activity using both GST substrates (e.g., CDNB) and peroxidase substrates to identify system-specific biases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.