Recombinant Human Mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11)

Shipped with Ice Packs
In Stock

Description

Recombinant Human Mitochondrial 2-Oxoglutarate/Malate Carrier Protein (SLC25A11): Overview

SLC25A11, also known as the mitochondrial 2-oxoglutarate/malate carrier protein (OGCP), is a membrane-bound transporter encoded by the SLC25A11 gene. It facilitates the electroneutral exchange of 2-oxoglutarate (α-ketoglutarate) for malate, succinate, or other dicarboxylic acids across the inner mitochondrial membrane . This function is critical for metabolic processes, including the malate-aspartate shuttle (MAS), gluconeogenesis, nitrogen metabolism, and mitochondrial glutathione (GSH) transport .

Key Features

ParameterDetails
Protein Length314 amino acids (AA 1–314)
Molecular Weight~37.8 kDa
LocalizationMitochondrial inner membrane
FunctionElectroneutral antiport of 2-oxoglutarate for malate/dicarboxylates
PathwaysMAS, oxoglutarate/isocitrate shuttle, gluconeogenesis, mitochondrial fusion/fission

Recombinant SLC25A11 is produced in heterologous systems (e.g., wheat germ, E. coli) for research applications, including SDS-PAGE, Western blotting (WB), and ELISA .

2.1. Protein Structure

SLC25A11 belongs to the mitochondrial carrier family (TC 2.A.29), characterized by six transmembrane helices and a conserved mitochondrial carrier motif . Recombinant versions are often produced with tags (e.g., GST, His) for purification and solubility .

Expression Systems

Host SystemTagPurityApplicationsReference
Wheat germNoneFull-lengthSDS-PAGE, ELISA, WB
E. coliGST/His>95%WB, IP, SDS-PAGE

2.2. Metabolic Roles

  • Malate-Aspartate Shuttle (MAS): Regenerates cytosolic NADH for mitochondrial ATP production by shuttling 2-oxoglutarate out and malate in .

  • Mitochondrial GSH Transport: Facilitates GSH import into mitochondria, reducing reactive oxygen species (ROS) .

  • Apoptosis Regulation: Modulates mitochondrial GSH levels; knockdown induces apoptosis in cancer cells but not normal cells .

3.1. Cancer Implications

a. Tumor Suppression and Metastasis
SLC25A11 knockdown in non-small cell lung cancer (NSCLC), melanoma, and liver cancer cells reduces ATP production, inhibits mTOR signaling, and suppresses proliferation . Key observations:

b. Genetic Mutations
Germline SLC25A11 mutations are linked to metastatic paraganglioma (pheochromocytoma) and exhibit pseudohypoxic/hypermethylator phenotypes, similar to SDHx-related tumors .

Disease Associations and Pathways

DiseaseSLC25A11 RoleMechanismReference
Liver CancerPrognostic biomarker (low expression)Impaired NADH transport, reduced ATP
ParagangliomaTumor suppressor (germline mutations)Loss of heterozygosity, pseudohypoxia
DiabetesRegulates insulin secretionModulates mitochondrial GSH and ATP

Experimental Applications and Limitations

Recombinant Protein Use

  • Applications:

    • Functional Studies: Reconstituted in liposomes to assay transport activity .

    • Immunological Tools: Used in WB to detect endogenous SLC25A11 in cancer vs. normal cells .

  • Limitations:

    • Partial Length Proteins: Some commercial products lack full-length sequences, affecting accuracy .

    • Host-Specific Modifications: Bacterial or wheat germ systems may alter post-translational modifications .

b. In Vivo Models
SLC25A11 knockout mice exhibit embryonic lethality, while conditional knockdown in cancer cells selectively induces apoptosis without affecting normal fibroblasts .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery time.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A11; SLC20A4; Mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Solute carrier family 25 member 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-314
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
SLC25A11
Target Protein Sequence
AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREY KTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD IAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG
Uniprot No.

Target Background

Function
The mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11) catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids. This protein plays a crucial role in various metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, gluconeogenesis from lactate, and nitrogen metabolism. It also contributes to the maintenance of mitochondrial fusion and fission events, as well as the organization and morphology of cristae. SLC25A11 is involved in the regulation of apoptosis and functions as a tumor-suppressor gene implicated in the predisposition to metastatic paraganglioma.
Gene References Into Functions
  1. Network analyses have identified SLC25A11 expression in the temporal cortex of patients with late-onset Alzheimer's disease. PMID: 28242297
  2. OGC serves as a model protein for understanding the transport mechanism of mitochondrial carriers. PMID: 23054077
  3. OGCP undergoes degradation through proteasome and lysosome degradation pathways. The degradation of parkin protein can promote the degradation of OGCP. PMID: 21500544
  4. Regulation of MISC-1/OGC function allows for control of mitochondrial morphology and cell survival decisions based on the metabolic needs of the cell. PMID: 21448454
  5. Data provide evidence for a role of the 2-oxoglutarate carrier as a glutathione transporting polypeptide PMID: 12939596
  6. Porphyrin accumulation in mitochondria is mediated by OGC, and porphyrins can competitively inhibit 2-oxoglutarate uptake into mitochondria. PMID: 16920706

Show More

Hide All

Database Links

HGNC: 10981

OMIM: 604165

KEGG: hsa:8402

STRING: 9606.ENSP00000225665

UniGene: Hs.184877

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

What is the primary biochemical function of SLC25A11 in mitochondrial metabolism?

SLC25A11 facilitates the electroneutral exchange of 2-oxoglutarate (2-OG) and malate across the mitochondrial inner membrane, a critical step in the malate-aspartate shuttle (MAS). This shuttle regenerates mitochondrial NAD+^+ by transferring cytosolic reducing equivalents into the matrix, enabling sustained activity of the tricarboxylic acid (TCA) cycle and oxidative phosphorylation .

Methodological Insight:

  • Transport Assays: Use purified recombinant SLC25A11 reconstituted into liposomes to measure 14^{14}C-labeled 2-OG/malate exchange rates under varying pH and substrate concentrations .

  • Genetic Knockout Models: CRISPR-Cas9-generated Slc25a11 Δ/Δ immortalized mouse chromaffin (imCC) cells exhibit disrupted MAS, leading to cytosolic NADH accumulation and pseudohypoxia .

How can researchers validate SLC25A11 expression and localization in cellular models?

  • Immunohistochemistry (IHC): Use validated anti-SLC25A11 antibodies on paraffin-embedded tissues. Loss of staining correlates with biallelic inactivation (germline mutation + LOH) .

  • Subcellular Fractionation: Isolate mitochondrial fractions via differential centrifugation, followed by Western blotting with compartment-specific markers (e.g., COX IV for mitochondria, GAPDH for cytosol) .

What standard techniques are used to study SLC25A11 transport kinetics?

  • Isotopic Flux Measurements: Incubate mitochondria with 13^{13}C-labeled 2-OG and quantify metabolite exchange via LC-MS.

  • Electrophysiology: Patch-clamp recordings of proteoliposomes incorporating SLC25A11 to assess voltage-dependent transport .

Advanced Research Questions

How do SLC25A11 mutations drive pseudohypoxic and hypermethylator phenotypes in tumors?

Key Findings:

  • Pseudohypoxia: SLC25A11 loss disrupts MAS, causing NAD+^+/NADH imbalance and HIF-1α stabilization even under normoxia .

  • Hypermethylation: Impaired 2-OG transport reduces substrate availability for TET/JmjC-domain demethylases, leading to global DNA/histone hypermethylation (e.g., loss of 5-hmC, H3K9me3 retention) .

Methodological Approaches:

  • CRISPR-Cas9 Models: Generate Slc25a11 Δ/Δ imCC cells and profile metabolites via GC-MS .

  • Methylation Arrays: Compare genome-wide 5-hmC/5-mC levels in SLC25A11-mutant vs. SDHx-mutant tumors using Infinium MethylationEPIC arrays .

What contradictions exist in SLC25A11’s role in ferroptosis, and how can they be resolved?

Data Conflict:

  • Study links SLC25A11 loss to tumorigenesis via pseudohypoxia, while implicates SLC25A11-FUNDC2 interactions in regulating mitochondrial glutathione (mitoGSH) and ferroptosis sensitivity.

Resolution Strategies:

  • Context-Specific Analysis: Use tissue-specific knockout models (e.g., chromaffin vs. epithelial cells) to dissect metabolic rewiring.

  • Integrated Omics: Perform parallel metabolomics (mitoGSH/GSSG ratios) and transcriptomics in SLC25A11-deficient cells under oxidative stress .

How can researchers address technical challenges in producing functional recombinant SLC25A11?

Challenges:

  • Membrane Protein Solubility: SLC25A11 requires detergents (e.g., DDM) for extraction but may lose activity during purification.

  • Functional Reconstitution: Liposome incorporation often yields <30% active protein.

Optimized Protocol:

  • Expression: Use Pichia pastoris with codon-optimized SLC25A11 for high-yield mitochondrial targeting.

  • Purification: Immobilized metal-affinity chromatography (IMAC) with a C-terminal His-tag.

  • Activity Validation: Compare transport rates with native mitochondrial extracts .

Data Integration Tables

Table 1. Clinico-Molecular Features of SLC25A11-Mutant PPGLs

PatientMutation TypeLOHMetastasisOGC IHC5-hmC Loss
1c.715C>AYesYesNegativeYes
2p.Ala236AlaYesNoNegativeNo
3FrameshiftYesYesNegativeYes
Data sourced from ; LOH = Loss of heterozygosity.

Table 2. Comparative Phenotypes of SLC25A11 vs. SDHx Mutations

FeatureSLC25A11 MutantsSDHB Mutants
Metastasis Rate71% (5/7)40–50%
5-hmC Loss83% (5/6)100%
HIF-1α StabilizationYesYes
Adapted from .

Methodological Recommendations

  • For Transport Studies: Combine isotopic tracing with computational modeling (e.g., COPASI) to simulate MAS dynamics.

  • For Cancer Models: Use orthotopic xenografts of SLC25A11-KO cells to assess metastatic potential in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.