Recombinant Human Mitochondrial carrier homolog 1 (MTCH1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MTCH1; PSAP; CGI-64; UNQ1871/PRO4314; Mitochondrial carrier homolog 1; Presenilin-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGASDPEVAPWARGGAAGMAGAGAGAGARGGAAAGVEARARDPPPAHRAHPRHPRPAAQP SARRMDGGSGGLGSGDNAPTTEALFVALGAGVTALSHPLLYVKLLIQVGHEPMPPTLGTN VLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQ VSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSI GKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPG SQFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLQAGLPPYSPVFKSWIHCW KYLSVQGQLFRGSSLLFRRVSSGSCFALE
Uniprot No.

Target Background

Function
Mitochondrial transporter with a potential role in apoptosis.
Gene References Into Functions

Functional Studies of MTCH1 (Mitochondrial Carrier Homolog 1):

  1. The transmembrane domain of Bcl-XL may be involved in protein oligomerization, as demonstrated with presenilin-1 associated protein. (PMID: 21856303)
  2. EGR-1 functions as a transcriptional regulator of MTCH1, providing insights into MTCH1's cellular roles. (PMID: 26692143)
  3. Neuro-Behçet's disease patients with positive Mtch1 antibody exhibited more attacks, increased disability, and reduced serum nucleosome levels. (PMID: 24035008)
  4. Cytochrome c-Apaf-1 apoptosome formation and Smac presence are essential for PSAP (Presenilin-associated protein)-induced apoptosis. (PMID: 23207240)
  5. MTCH1 is a strong candidate gene for mitochondrial diseases, based on recessive mutations in infantile patients. (PMID: 22277967)
  6. MTCH1's mitochondrial localization and proapoptotic activity highlight its role in apoptosis regulation. (PMID: 12377771)
  7. Alternative splicing generates two proapoptotic PSAP isoforms, both imported into the mitochondrial outer membrane via multiple internal targeting signals and containing two proapoptotic domains. (PMID: 17670888)
  8. All PSAP isoforms are localized in the mitochondria and exhibit pro-apoptotic activity. (PMID: 18291114)
Database Links

HGNC: 17586

OMIM: 610449

KEGG: hsa:23787

STRING: 9606.ENSP00000362718

UniGene: Hs.485262

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed with a predominant expression in brain.

Q&A

Basic Research Questions

  • What is Mitochondrial carrier homolog 1 (MTCH1) and what is its primary cellular location?

Mitochondrial carrier homolog 1 (MTCH1), also known as presenilin 1-associated protein (PSAP), is a protein encoded by the MTCH1 gene located on chromosome 6 in humans . MTCH1 primarily localizes to the outer mitochondrial membrane (OMM), as confirmed by subcellular fractionation studies showing its presence in mitochondrial fractions alongside mitochondrial markers, with minimal detection in cytosolic fractions and no presence in endoplasmic reticulum compartments . The protein is expressed in at least 16 different tissue types, suggesting it may serve housekeeping functions throughout the body .

Methodological approach: To study MTCH1 localization, researchers typically employ subcellular fractionation techniques with appropriate markers (e.g., Hexokinase1 for cytosol, Erv2 for ER, and Hep1 for mitochondria) followed by western blot analysis to detect MTCH1 presence in various cellular compartments .

  • What are the key structural features of MTCH1?

MTCH1's structure includes several key elements that determine its functional capabilities:

  • The MTCH1 gene contains 12 exons and produces four isoforms through alternative splicing

  • These isoforms arise from alternative splicing of exon 8 and two potential start codons

  • Some isoforms feature a deletion of 17 amino acid residues in the hydrophilic loop between two transmembrane domains

  • All isoforms share similar topological structure with six transmembrane domains

  • Contains two N-terminal apoptotic domains required for its proapoptotic function

Methodological approach: Structure analysis of MTCH1 typically involves sequence alignment tools, hydropathy plot analysis, and topology prediction algorithms. Experimental validation may include epitope tagging of different regions followed by accessibility studies using protease protection assays or domain-specific antibodies.

  • How is gene manipulation of MTCH1 achieved in laboratory settings?

Researchers have successfully employed several techniques to manipulate MTCH1 expression:

  • CRISPR/Cas9 technology: MTCH1 knockout has been achieved using synthesized sgRNA (5′-CTCTACTGTGACTCGGGGTA-3′) linked to CRISPR-Cas9 plasmid vectors. After transfection, GFP-positive cells can be selected by flow cytometry, with knockout verification through sequencing to confirm frameshift mutations .

  • RNA interference: Lentiviral vectors encoding short hairpin RNAs (shRNAs) targeting MTCH1 have been used to establish stable knockdown cell lines .

  • siRNA transfection: Transient MTCH1 knockdown has been achieved through siRNA transfection, with validation of knockdown efficiency through quantitative RT-PCR showing significant reduction in MTCH1 mRNA levels .

Functional validation of MTCH1 knockdown typically includes assessing changes in cell proliferation (using CCK-8 assays), migration and invasion capabilities (using Transwell assays), and mitochondrial function parameters .

  • What experimental models are commonly used to study MTCH1 function?

Several model systems have proven valuable for MTCH1 research:

  • Human cancer cell lines: HeLa (cervical cancer) cells have been used for MTCH1 knockout studies using CRISPR/Cas9 . Liver hepatocellular carcinoma cell lines (BEL-7402 and MHCC-97H) have been utilized for MTCH1 knockdown experiments .

  • Drosophila melanogaster: Studies depleting the Drosophila Mtch ortholog (CG6851) have revealed its role in development and apoptosis regulation .

  • Saccharomyces cerevisiae (yeast): Valuable for studying MTCH1's insertase function through complementation studies in strains lacking MIM complex components .

  • Mouse xenograft models: Used to evaluate the effects of MTCH1 targeting in combination with clinical drugs like Sorafenib on tumor growth in vivo .

Methodological approach: Selection of the appropriate model system should be guided by specific research questions, with consideration of species-specific differences in MTCH1 function observed between different organisms .

  • What are the primary assays used to evaluate MTCH1 cellular functions?

Several methodological approaches have proven effective for studying MTCH1 functions:

  • Cell proliferation assays: CCK-8 (Cell Counting Kit-8) assays can quantify changes in cell proliferation following MTCH1 manipulation .

  • Migration and invasion assays: Transwell assays effectively measure MTCH1's influence on cancer cell migration and invasion capabilities .

  • Mitochondrial function assessment: Measurements of mitochondrial reactive oxygen species (ROS), membrane potential, and oxidative phosphorylation provide insights into MTCH1's impact on mitochondrial biology .

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): Used to analyze MTCH1's role in complex assembly, such as TOM complex formation and stability .

  • Subcellular fractionation: Combined with western blotting to confirm MTCH1 localization patterns and protein levels across different cellular compartments .

Methodological approach: Researchers should employ multiple complementary assays and include appropriate controls to comprehensively characterize MTCH1 function in their specific experimental context.

Advanced Research Questions

  • What is the role of MTCH1 in apoptotic and ferroptotic cell death pathways?

MTCH1 plays complex roles in both apoptotic and ferroptotic pathways:

Apoptotic pathway:

  • MTCH1 functions as a proapoptotic protein that can induce apoptosis independently of BCL-2 family proteins but requires SMAC (Second Mitochondria-derived Activator of Caspases)

  • MTCH1 can mediate presenilin 1-induced apoptosis by forming a complex with BAX

  • It may function as a receptor or anchor for BAX under specific apoptotic conditions when present at endogenous levels

  • MTCH1 may interact with the mitochondrial permeability transition pore complex, leading to mitochondrial membrane depolarization, cytochrome C release, and caspase-3 activation

Ferroptotic pathway:

  • MTCH1 governs ferroptosis through retrograde signaling to the FoxO1-GPX4 axis

  • MTCH1 deficiency disrupts mitochondrial oxidative phosphorylation and elevates mitochondrial ROS by decreasing NAD+ levels

  • This initiates mitochondria-to-nucleus retrograde signaling involving reduced FoxO1 nuclear translocation

  • Reduced FoxO1 translocation leads to downregulation of glutathione peroxidase 4 (GPX4), a key anti-ferroptosis enzyme

  • The resulting elevation of ROS ultimately triggers ferroptosis

Methodological approach: Investigating MTCH1's role in cell death requires measuring multiple parameters including mitochondrial ROS levels, GPX4 expression and activity, FoxO1 localization (nuclear vs. cytoplasmic), and specific markers of apoptosis and ferroptosis. Combining genetic manipulation of MTCH1 with pharmacological agents targeting specific cell death pathways can help elucidate its precise functions.

  • How does MTCH1 function as a mitochondrial insertase?

Recent research reveals MTCH1's role as a protein insertase:

  • MTCH1 can function as an insertase for α-helical proteins in the outer mitochondrial membrane

  • In yeast complementation studies, MTCH1 expression can rescue growth defects associated with deletion of MIM complex components (Mim1, Mim2, or both)

  • MTCH1 expression alleviates TOM complex assembly defects in mim1Δ and mim1/2ΔΔ strains

  • It reduces accumulation of TOM complex intermediates (~100 kDa) and promotes formation of the assembled TOM complex (~440 kDa)

  • MTCH1 improves import of model fusion proteins like pSu9-DHFR

  • This insertase activity appears to be inherent to MTCH1 itself, not requiring additional factors

Methodological approach: To study MTCH1's insertase function, researchers can use heterologous expression in yeast MIM complex deletion strains, followed by analysis of growth rates, TOM complex assembly using blue native gel electrophoresis, and import efficiency of model substrates. Direct measurement of insertase activity can be performed using cell-free translation systems with radiolabeled substrate proteins.

  • What is known about MTCH1's role in regulating the FoxO1-GPX4 axis?

MTCH1 interacts with the FoxO1-GPX4 axis through several mechanisms:

  • MTCH1 deficiency initiates mitochondria-to-nucleus retrograde signaling affecting FoxO1

  • Decreased MTCH1 levels disrupt mitochondrial oxidative phosphorylation and elevate mitochondrial ROS by reducing NAD+ levels

  • Increased ROS and altered mitochondrial function reduce FoxO1 nuclear translocation

  • Reduced nuclear FoxO1 leads to downregulation of both transcription and activity of glutathione peroxidase 4 (GPX4)

  • GPX4 downregulation elevates cellular ROS levels, ultimately triggering ferroptosis

Methodological approach: Investigation of this axis requires measuring subcellular localization of FoxO1 through cell fractionation or immunofluorescence, assessing GPX4 expression at both mRNA and protein levels, quantifying GPX4 activity, and monitoring cellular NAD+ levels and mitochondrial function parameters after MTCH1 manipulation.

  • How does MTCH1 contribute to cancer progression and what is its potential as a therapeutic target?

MTCH1 has been implicated in cancer progression through multiple mechanisms:

In Liver Hepatocellular Carcinoma (LIHC):

In Cervical Cancer:

  • MTCH1 functions as a central mediator of resistance to mitochondrial-mediated ferroptosis

  • MTCH1 deficiency promotes ferroptosis by disrupting mitochondrial function and downregulating GPX4

  • Targeting MTCH1 in combination with Sorafenib effectively and synergistically inhibits cervical cancer growth in nude mouse xenograft models by inducing ferroptosis

Methodological approach: To evaluate MTCH1 as a therapeutic target, researchers should:

  • Confirm MTCH1 expression levels in cancer vs. normal tissues using qRT-PCR and immunohistochemistry

  • Correlate expression with clinical parameters through Kaplan-Meier survival analysis

  • Assess effects of MTCH1 knockdown on cancer hallmarks using in vitro and in vivo models

  • Test combinatorial approaches that target MTCH1 together with established therapeutics

  • What are the discrepancies in MTCH1 function between different model organisms?

The search results reveal interesting discrepancies in MTCH1 function across species:

Human studies:

  • MTCH1 is proapoptotic when overexpressed

  • Acts as an oncogene in certain cancers, with high expression associated with poor outcomes

  • Implicated in neurological disorders through its interaction with presenilin 1

Drosophila studies:

  • Depletion of the Drosophila Mtch ortholog prevents completion of development

  • Mutant flies show excess apoptosis during pupation

  • RNAi in Schneider cells confirms increased apoptosis upon Mtch depletion

  • These findings contradict human studies where MTCH1 is proapoptotic when overexpressed

Yeast studies:

  • MTCH1 can functionally complement the absence of Mim proteins

  • Restores growth, MIM substrate biogenesis, and TOM complex stability

  • MTCH2, despite structural similarities to MTCH1, has negative effects on yeast growth

Methodological approach: When studying MTCH1, researchers should carefully consider species-specific differences and avoid direct extrapolation between model systems. Validation of findings across multiple models is essential, and experimental approaches should be tailored to the specific model system being used.

  • What techniques are most effective for studying MTCH1 protein-protein interactions?

Several techniques have proven effective for studying MTCH1 interactions:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): Especially useful for analyzing MTCH1's role in complex assembly, such as TOM complex formation and stability

  • Co-immunoprecipitation: Helps identify interacting partners such as presenilin 1 and BAX

  • Subcellular fractionation: Combined with western blotting to confirm MTCH1 localization and potential co-localization with interaction partners

  • Proximity labeling approaches: BioID or APEX2 can identify proteins in proximity to MTCH1 in intact cells

  • Yeast complementation studies: Valuable for functional analysis, as demonstrated by MTCH1's ability to complement MIM complex deficiency

Methodological approach: When studying MTCH1 interactions, researchers should employ complementary techniques and include appropriate controls. The choice of methods should consider the subcellular localization of MTCH1 and potential interaction partners, as well as whether interactions are likely to be stable or transient.

  • How does MTCH1 complementation function in yeast lacking MIM complexes?

MTCH1 complementation in MIM-deficient yeast involves several mechanisms:

  • MTCH1 localizes to yeast mitochondria even in the absence of Mim1 and/or Mim2, as confirmed by subcellular fractionation

  • When expressed in yeast strains lacking Mim components, MTCH1:

    • Rescues growth defects in both solid and liquid media

    • Restores steady-state levels of α-helical mitochondrial outer membrane proteins

    • Reconstitutes TOM complex assembly

    • Improves mitochondrial morphology

Specific molecular mechanisms include:

  • Alleviating TOM complex assembly defects observed in mim1Δ and mim1/2ΔΔ strains

  • Reducing accumulation of TOM complex intermediates (~100 kDa)

  • Promoting formation of assembled TOM complex (~440 kDa) to levels comparable to wild-type

  • Improving import of model fusion proteins like pSu9-DHFR

This functional complementation occurs despite the absence of evolutionary conservation between MTCH1 and yeast MIM proteins, suggesting MTCH1 possesses inherent insertase activity. Notably, MTCH2 (a paralog of MTCH1) cannot complement MIM functions and actually exhibits negative effects on yeast growth .

Methodological approach: To study this complementation, researchers can express MTCH1 in yeast strains lacking MIM components and assess growth rates, mitochondrial morphology, and molecular parameters of mitochondrial protein import and complex assembly.

Table 1: Comparison of MTCH1 Functions Across Different Experimental Models

Model SystemMTCH1 Expression EffectKey ObservationsMethodologyReference
Human cervical cancer cellsKnockdownPromotes ferroptosis via FoxO1-GPX4 axis; enhances Sorafenib efficacyCRISPR/Cas9 knockout; mouse xenograft models
Human liver cancer cellsKnockdownSuppresses proliferation, migration, and invasionsiRNA; CCK-8 and Transwell assays
Saccharomyces cerevisiaeOverexpressionRescues growth in MIM-deficient strains; restores TOM complex assemblyHeterologous expression; BN-PAGE analysis
Drosophila melanogasterDepletionIncreased apoptosis; developmental failureRNAi; phenotypic analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.