Recombinant Human Mitochondrial carrier homolog 2 (MTCH2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Mitochondrial Carrier Homolog 2 (MTCH2)

Mitochondrial carrier homolog 2 (MTCH2), a protein located on the outer mitochondrial membrane, belongs to the solute carrier 25 family . It was first identified in 2000, and research on its functions is rapidly expanding . MTCH2 is involved in various cellular processes, including apoptosis, energy metabolism, mitochondrial dynamics, and more .

Structure and Function

MTCH2 functions as an insertion enzyme for α-helical mitochondrial outer membrane proteins and transports metabolites to the mitochondrial matrix . It also serves as a membrane channel for proteins entering the mitochondria . The most well-known function of MTCH2 is its role in inducing apoptosis . Specifically, MTCH2 binds to the pro-apoptotic B-cell lymphoma 2 family member, cleaved BH3-interacting domain death agonist (cBID), to regulate mitochondrial apoptosis .

The process involves the following steps :

  • MTCH2 recruits cBID to the mitochondria, which unmasks the BH3 domain of cBID.

  • A complex of cBID, BAX, and MTCH2 is formed.

  • This complex drives tBID (truncated BID) into a highly extended conformation.

  • Segments of 59–73 and 111–125 of tBID cross-link to 140–161 and 240–290 of MTCH2, respectively.

Role in Mitochondrial Dynamics

MTCH2 plays a role in mitochondrial dynamics, specifically in mitochondrial fusion . It is required for starvation-dependent mitochondrial hyperfusion, a cytoprotective response to nutrient deprivation . MTCH2 stimulates mitochondrial fusion in a manner dependent on lysophosphatidic acid (LPA), linking mitochondrial dynamics to lipogenesis .

  • Mitochondrial Fusion: MTCH2 promotes mitochondrial elongation by stimulating mitochondrial fusion . Loss of MTCH2 leads to mitochondrial fragmentation, while overexpression results in mitochondrial hyperfusion .

  • Starvation-Induced Mitochondrial Hyperfusion (SIMH): MTCH2 is a selective component of the starvation-dependent SIMH pathway . It mediates mitochondrial hyperfusion under starvation conditions, distinguishing it from other SIMH pathways induced by translational inhibition or ER stress .

Impact on Energy Metabolism

MTCH2 influences cellular energy metabolism by regulating ATP production and mitochondrial function .

  • ATP Production: Overexpression of MTCH2 increases ATP production, while decreased MTCH2 expression reduces ATP production .

  • Mitochondrial Function: Loss of MTCH2 results in mitochondrial dysfunction, increased energy demand, and an oxidized cellular environment . MTCH2 deletion leads to elevated utilization of lipids, amino acids, and carbohydrates, accompanied by a decrease in several metabolites .

Involvement in Diseases

Genetic variants and altered expression of MTCH2 have been associated with various diseases :

  • Metabolic Diseases: MTCH2 plays a crucial role in metabolic diseases by regulating mitochondrial function and the metabolic shift between glycolysis and oxidative phosphorylation .

  • Neurodegenerative Diseases: MTCH2 is implicated in neurodegenerative diseases through its regulation of mitochondrial apoptosis and function .

  • Cancers: MTCH2 promotes the malignant progression of various cancers, including ovarian and gastric cancer . It enhances cell proliferation, migration, and invasion while inhibiting apoptosis .

  • Embryonic Development and Reproduction: MTCH2 is involved in embryonic development and reproduction, with its functions primarily linked to the regulation of mitochondrial function .

MTCH2 in Cancer Progression

MTCH2 has been shown to promote the malignant progression of several cancers .

  • Ovarian Cancer: MTCH2 promotes ovarian cancer cell proliferation and inhibits apoptosis . It also regulates energy metabolism in ovarian cancer cells, increasing ATP production and maintaining mitochondrial function .

  • Gastric Cancer: MTCH2 increases the malignant phenotype of human gastric epithelial cells and promotes the proliferation, invasion, and migration of gastric cancer cells .

  • Colon Cancer: MTCH2 is identified as a gene driving the progression of colon cancer .

MTCH2 and Obesity

Loss of MTCH2 results in increased whole-body energy utilization and protection against diet-induced obesity . MTCH2 knockout cells exhibit increased mitochondrial oxidative function, leading to a catabolic and oxidative environment that prevents adipocyte differentiation and lipid accumulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MTCH2; MIMP; HSPC032; Mitochondrial carrier homolog 2; Met-induced mitochondrial protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MTCH2
Target Protein Sequence
ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHI ASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVI KETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAG LVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVS NLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKM LI
Uniprot No.

Target Background

Function
Substrate remains unidentified. Induces mitochondrial depolarization.
Gene References Into Functions

MTCH2 Function and Related Research:

  1. Cav1 and MTCH2 are identified as DHA targets, linking upstream Cav1/MTCH2 upregulation to downstream cell death pathway activation, inhibiting cell viability. PMID: 28498397
  2. MTCH2 and cardiolipin facilitate tBID recruitment and integration into the mitochondrial outer membrane. PMID: 26794447
  3. Review: The BID-MTCH2 axis regulates stem cell differentiation/apoptosis and mitochondrial metabolism. PMID: 26827940
  4. Mtch2 accelerates the conformational change in membrane-bound tBid, activating Bax. PMID: 23744079
  5. TMEM18, BDNF, MTCH2, and NEGR1 are implicated in adipocyte differentiation and biology; MAF expression varies during adipogenesis, while NPC1, PTER, and SH2B1 are not regulated. PMID: 23229156
  6. SH2B1's importance in insulin sensitivity is supported, with potential roles for NEGR1 and MTCH2. PMID: 22443470
  7. Molecular basis of the interaction between proapoptotic truncated BID (tBID) and MTCH2. PMID: 22416135
  8. Gene-treatment interactions observed for short-term weight loss (MTCH2 rs10838738, Plifestyle*SNP = 0.022). PMID: 22179955
  9. MTCH2 may play a role in cellular processes underlying obesity. PMID: 21795451
  10. MTCH2 rs10838738 is associated with higher BMI. PMID: 19910938
  11. Mtch2 is a mitochondrial tBID target, potentially participating in the mitochondrial apoptotic program. PMID: 15899861
Database Links

HGNC: 17587

OMIM: 613221

KEGG: hsa:23788

STRING: 9606.ENSP00000303222

UniGene: Hs.269944

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are most reliable for characterizing MTCH2’s role in mitochondrial dynamics?

To investigate MTCH2’s role in mitochondrial fusion/fission dynamics, researchers should employ a multi-modal strategy:

  • CRISPR-Cas9 knockout models: Generate MTCH2−/− cell lines (e.g., HCT116 or HeLa) and validate mitochondrial fragmentation via live-cell imaging with matrix-targeted fluorescent probes (e.g., mito-mCherry) .

  • Rescue experiments: Reintroduce GFP-tagged MTCH2 variants to confirm phenotype reversibility and assess localization .

  • Fission/fusion assays: Quantify mitochondrial elongation using morphometric analysis (e.g., aspect ratio, branch count) under nutrient deprivation or ER stress .

  • DRP1 activity monitoring: Use phospho-specific antibodies (S616/S637) and immunofluorescence to track DRP1 recruitment in knockout vs. wild-type cells .

Table 1: Key Mitochondrial Dynamics Parameters in MTCH2 Studies

ParameterWT PhenotypeMTCH2−/− PhenotypeAssay Type
Network elongationHyperfusedFragmentedConfocal microscopy
DRP1 phosphorylationBaseline levelsNo significant changeWestern blot
Stress responseSIMH activationSIMH impairmentLive-cell imaging

How does MTCH2 influence cellular lipid metabolism in standard culture conditions?

MTCH2 regulates lipid flux through two mechanistically distinct pathways:

  • Lipogenesis coupling: Monitor lysophosphatidic acid (LPA) levels via LC-MS in MTCH2−/− cells, as MTCH2 interacts with AGPAT5 to modulate LPA-PA conversion .

  • Metabolic profiling: Conduct temporal metabolomics to quantify ATP/ADP ratios, NAD+/NADH redox states, and fatty acid β-oxidation rates . In HeLa knockouts, expect 2.3-fold increased palmitate utilization and 40% reduction in membrane phospholipids .

  • Lipid droplet analysis: Use Nile Red staining to compare lipid storage between genotypes, noting 1.8-fold larger droplets in MTCH2-depleted cells .

What validation steps are critical when using recombinant MTCH2 in in vitro insertion assays?

While current studies focus on endogenous MTCH2 , recombinant protein applications require:

  • Topology verification: Confirm outer membrane localization via protease protection assays with proteinase K/TRYPSIN .

  • Functional reconstitution: Test insertion efficiency into proteoliposomes using radiolabeled TA proteins (e.g., BCL2L1), comparing wild-type vs. hydrophilic groove mutants (e.g., MTCH2-R134A) .

  • Crosslinking controls: Perform disuccinimidyl suberate (DSS) crosslinking to validate substrate interactions during insertion .

How can researchers reconcile MTCH2’s dual roles in mitochondrial fusion and protein insertion?

The apparent duality arises from MTCH2’s structural adaptation of the SLC25 transporter fold, enabling both metabolite sensing and insertase activity . To dissect these functions:

  • Conditional mutagenesis: Engineer separation-of-function mutations (e.g., LPA-binding vs. insertase domains) using site-directed mutagenesis.

  • Parallel assays: In the same cell line, measure:

    • Fusion rates via photoactivatable GFP recovery after nutrient starvation

    • TA protein insertion efficiency using in vitro translated [35S]-labeled substrates

  • Lipid supplementation: Test whether exogenous LPA (10-100 μM) rescues fusion defects without altering insertase activity .

Table 2: Functional Domains of MTCH2

DomainFusion RoleInsertase RoleKey Residues
Hydrophilic grooveLPA interactionTA protein recognitionR134, E189, Q227
Transmembrane helicesMetabolite sensingMembrane integrationF56, W203, L241

What integrated omics strategies clarify MTCH2’s metabolic regulatory network?

A three-tiered omics approach is recommended:

  • Metabolomics: Perform time-course GC-MS to track TCA cycle intermediates (e.g., 2.1-fold increase in α-ketoglutarate in knockouts ).

  • Lipidomics: Use shotgun lipidomics to quantify:

    • Membrane lipids (30% decrease in phosphatidylserine)

    • Storage lipids (2.5-fold increase in triacylglycerols)

  • Proteomics: Combine APEX2-based proximity labeling with TMT multiplexing to identify MTCH2 interactors (e.g., AGPAT5, GPAT1) .

How does MTCH2 deletion differentially impact energy metabolism across cell types?

Cell-type-specific effects necessitate:

  • Respiratory analysis: Compare OCR/ECAR ratios using Seahorse XF technology. HeLa knockouts show 35% higher basal respiration but NIH3T3L1 preadipocytes fail differentiation due to redox imbalance .

  • Differentiation assays: For adipocyte studies, monitor PPARγ activation and lipid accumulation post-MTCH2 knockout. Use 0.5 mM IBMX + 1 μM dexamethasone to induce differentiation, noting 80% reduction in lipid droplet formation .

  • Redox monitoring: Employ roGFP2-Orp1 probes to quantify H2O2 levels, which increase by 2.4-fold in MTCH2-depleted cells .

What controls are essential when investigating MTCH2’s role in apoptosis sensitivity?

Given MTCH2’s dual roles in membrane insertion and death signaling :

  • Substrate titration: Titrate recombinant BCL2 proteins (0.1-10 μg/mL) to establish insertion-dependent protection thresholds.

  • Kinetic profiling: Measure caspase-3/7 activation every 30 minutes post-treatment with 1 μM staurosporine.

  • Genetic cross-talk analysis: Use double knockouts (e.g., MTCH2−/−/BAX−/−) to isolate insertase vs. fusion contributions to apoptosis.

Methodological Recommendations

  • CRISPR design: For MTCH2 targeting, use dual sgRNAs (exons 2-4) with HDR templates containing auxotrophic markers to minimize off-target effects .

  • Imaging parameters: Acquire z-stacks at 0.2 μm intervals using 60x NA 1.4 objectives to resolve mitochondrial networks .

  • Data interpretation: Normalize lipidomics data to total protein carbon content to account for MTCH2’s catabolic effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.