Recombinant Human Solute carrier family 25 member 51 (SLC25A51)

Shipped with Ice Packs
In Stock

Description

Transport Mechanism

SLC25A51 preferentially binds oxidized NAD+ through three contact sites involving residues T94, N183, and R278 . Unlike other SLC25 transporters, it lacks a canonical substrate-binding motif but retains NAD+ specificity through electrostatic interactions with the adenine dinucleotide .

Metabolic Consequences of Deficiency

PhenotypeExperimental Evidence
Reduced mitochondrial respirationOCR decreased by 60–70% in ΔSLC25A51 HAP1 cells
Depleted mitochondrial NAD+NAD+ levels reduced by 85% in KO mitochondria
Impaired TCA cycle activityLower α-ketoglutarate, citrate, and malate levels observed

Implications in Cancer Metabolism

SLC25A51 contributes to metabolic reprogramming in hepatocellular carcinoma (HCC) and colorectal cancer (CRC):

Cancer TypeMechanismOutcome
HCCActivates SIRT5 via NAD+ transport, enhancing glycolysis and reducing OXPHOS Increased glucose uptake and metastasis
CRCSupports SIRT3-mediated deacetylation of SOD2, reducing oxidative stress Promotes tumor growth under metabolic stress

Research Applications

Recombinant SLC25A51 enables:

  • Functional rescue experiments: Expression restores NAD+ levels and mitochondrial respiration in KO cells .

  • Mechanistic studies: Used to map transport dynamics via cryo-EM and molecular docking .

  • Therapeutic targeting: Identified as a vulnerability in cancers dependent on mitochondrial NAD+ .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A51; MCART1; Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51; Mitochondrial NAD(+ transporter SLC25A51; Mitochondrial carrier triple repeat protein 1; Solute carrier family 25 member 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A51
Target Protein Sequence
MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQL YGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFAT SGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPIL FRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQ SQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI
Uniprot No.

Target Background

Function
Mitochondrial membrane carrier protein that mediates the import of NAD(+) into mitochondria. Mitochondrial NAD(+) is essential for glycolysis and mitochondrial respiration. Compared to SLC25A52, SLC25A51-mediated transport is crucial for the import of NAD(+) into mitochondria.
Database Links

HGNC: 23323

KEGG: hsa:92014

STRING: 9606.ENSP00000242275

UniGene: Hs.634120

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization and cellular localization of SLC25A51?

SLC25A51 belongs to the SLC25 family of mitochondrial carriers. The protein contains six transmembrane regions with its N and C termini exposed toward the mitochondrial intermembrane space . It shows close homology to the paralogs SLC25A52 and, to a lesser extent, SLC25A53 . SLC25A51 localizes specifically to the mitochondria, as confirmed by co-staining experiments with mitochondrial markers such as apoptosis-inducing factor (AIF) .

To verify mitochondrial localization in your research:

  • Use fluorescently tagged SLC25A51 constructs and co-localize with established mitochondrial markers

  • Perform subcellular fractionation followed by Western blot analysis

  • Consider mitochondrial import assays to validate the targeting sequence functionality

What is the tissue expression pattern and evolutionary conservation of SLC25A51?

Transcriptomics data analysis demonstrates that SLC25A51 is widely and robustly expressed across human tissues, unlike its paralog SLC25A52, which shows more limited expression . The functional importance of SLC25A51 is reflected in its high evolutionary conservation, with fewer than 1 in 2000 individuals carrying putative deleterious mutations, making it one of the most functionally conserved SLCs across humans .

Expression analysis methods for your research:

  • RNA-seq or qPCR across tissue panels

  • Immunohistochemistry with validated antibodies

  • Single-cell RNA sequencing for cell-type specific expression patterns

How does SLC25A51 function as a mitochondrial NAD+ transporter?

SLC25A51 serves as the mammalian mitochondrial NAD+ transporter, facilitating the movement of this critical cofactor into mitochondria where it's required for numerous metabolic reactions and redox processes . This function was established through complementation studies with yeast NAD+ transporters (Ndt1p and Ndt2p), which can functionally rescue the respiratory defects in SLC25A51-deficient cells . Similarly, human SLC25A51 expression in yeast Δndt1Δndt2 strains rescues their growth defects in minimal medium supplemented with ethanol and partially restores mitochondrial NAD+ levels .

To verify NAD+ transport function:

  • Direct measurement of NAD+ levels in isolated mitochondria

  • Isotope-labeled NAD+ uptake assays in reconstituted systems

  • Complementation studies with known NAD+ transporters

  • Metabolomic profiling of NAD+-dependent pathways

What are robust methods for generating and validating SLC25A51-deficient cell models?

For effective SLC25A51 knockdown or knockout models:

CRISPR-Cas9 knockout approach:

  • Target early exons to ensure complete loss of function

  • Screen multiple guide RNAs to identify efficient targeting sequences

  • Validate knockout through Western blot, qPCR, and sequencing

  • Create clonal cell lines with confirmed biallelic disruption

Validation steps:

  • Confirm mRNA and protein loss using qPCR and Western blot

  • Measure mitochondrial NAD+ levels using luminescence-based assays or HPLC

  • Assess mitochondrial respiration through oxygen consumption rate (OCR) measurements

  • Perform rescue experiments with wild-type SLC25A51 to confirm phenotype specificity

Based on published protocols, HAP1 cells have been successfully used to generate SLC25A51-deficient clones that display characteristic respiratory defects .

How can mitochondrial NAD+ levels be accurately measured in SLC25A51 research?

Several complementary approaches can be used:

HPLC-based method:

  • Isolate mitochondria using differential centrifugation

  • Extract nucleotides with 1.2M ice-cold perchloric acid

  • Neutralize with 30% KOH

  • Centrifuge, filter, and analyze by HPLC

  • Use a C18 column (e.g., Kinetex EVO C18) with phosphate buffer containing tetra-n-butyl-ammonium bisulfate and acetonitrile gradient

  • Monitor at 254 nm

Luminescence-based assay:

  • Commercial kits are available for NAD+/NADH measurements

  • Ensure proper mitochondrial isolation to prevent cytosolic contamination

  • Include appropriate controls (e.g., SLC25A3-deficient cells) for comparison

Metabolomic profiling:

  • LC-MS/MS-based targeted metabolomics can provide comprehensive NAD+ metabolome analysis

  • Include related metabolites (NADH, NADP+, NADPH, nicotinamide) for pathway assessment

What experimental approaches can assess mitochondrial respiration in SLC25A51-deficient cells?

Oxygen Consumption Rate (OCR) measurement:

  • Use Seahorse XF Analyzer or similar equipment

  • Measure basal respiration, ATP production, maximal respiration, and spare respiratory capacity

  • Include appropriate controls (e.g., SLC25A3-deficient cells and SLC25A13-deficient cells)

  • Perform rescue experiments with SLC25A51 expression constructs to confirm specificity

Respirometry using Clark-type electrodes:

  • Measure oxygen consumption in intact cells or isolated mitochondria

  • Assess the effects of different substrates and inhibitors

Mitochondrial membrane potential measurements:

  • Use potentiometric dyes (TMRM, JC-1)

  • Flow cytometry or fluorescence microscopy-based analysis

Published data shows that SLC25A51-deficient cells exhibit respiratory defects comparable to SLC25A3-deficient cells, but these defects are rescued only by re-expression of SLC25A51, not SLC25A3, indicating non-redundant functions .

How does SLC25A51 contribute to cancer cell metabolism and proliferation?

SLC25A51 has been identified as upregulated in multiple cancer types, promoting cancer cell proliferation . The mechanism appears to involve:

  • Maintenance of mitochondrial NAD+ levels

  • Support of NAD+-dependent metabolic reactions crucial for cancer cell growth

  • Regulation of mitochondrial protein acetylation through NAD+-dependent SIRT3 activity

  • Modulation of proline biosynthesis through P5CS enzymatic activity

Experimental approaches to investigate cancer relevance:

  • Analyze SLC25A51 expression across cancer databases (TCGA, CCLE)

  • Perform loss-of-function studies in cancer cell lines and xenograft models

  • Assess metabolic changes using metabolomics and 13C-labeled substrates

  • Evaluate synergy with other metabolic pathways critical for cancer growth

Cancer TypeSLC25A51 Expression PatternReference
Multiple cancersUpregulated compared to normal tissue
Cancer cell modelsPromotes proliferation

What is the relationship between SLC25A51, mitochondrial protein acetylation, and SIRT3 function?

Loss of SLC25A51 leads to elevated mitochondrial protein acetylation levels due to SIRT3 dysfunction . SIRT3 is an NAD+-dependent deacetylase, and insufficient mitochondrial NAD+ resulting from SLC25A51 deficiency impairs its activity.

Key research observations:

  • SLC25A51 deficiency reduces mitochondrial NAD+ levels

  • This leads to hyperacetylation of mitochondrial proteins

  • SIRT3 activity is compromised due to insufficient NAD+ cofactor

  • P5CS (Δ1-pyrroline-5-carboxylate synthase), a key enzyme in proline biosynthesis, shows reduced activity when hyperacetylated

Methodological approaches:

  • Acetylome analysis using mass spectrometry

  • SIRT3 activity assays in the presence/absence of SLC25A51

  • Site-directed mutagenesis of key acetylation sites on target proteins

  • NAD+ supplementation experiments to rescue SIRT3 activity

How do genetic interactions inform our understanding of SLC25A51 function?

Genetic interaction networks provide valuable insights into SLC25A51's functional role:

Strong negative interactions with:

  • SLC2A1/GLUT1 (main glucose transporter)

  • SLC7A5 and SLC43A2 (methionine transporters)

  • SLC43A3 (purine salvage pathway transporter)

  • SLC25A53 (paralog with unknown function)

  • SLC25A32 (putative folate/FAD transporter)

Strong positive interactions with:

  • SLC7A11 and SLC3A2 (subunits of xCT glutamate/cystine transporter)

  • SLC25A3 (mitochondrial phosphate carrier)

Interpretation of these interactions:

  • Connections to glycolytic metabolism through SLC2A1 interaction

  • Links to one carbon metabolism and redox pathways through methionine transporters and xCT

  • Functional overlap with other mitochondrial transporters, particularly within the SLC25 family

  • Role in supporting mitochondrial cofactor levels and energetics

Co-essentiality analysis further reveals correlation between SLC25A51 and genes encoding electron transport chain components, ATP synthase, mitochondrial ribosome, and other mitochondrial cofactor transporters (SLC25A26, SLC25A19, SLC25A32) .

How can SLC25A51 be targeted for potential cancer therapies?

Research has identified fludarabine phosphate, an FDA-approved drug, as a SLC25A51 inhibitor . This inhibition leads to:

  • Decreased mitochondrial NAD+ levels

  • Increased mitochondrial protein acetylation

  • Reduced cancer cell proliferation

The therapeutic approach can be enhanced by combining fludarabine phosphate with aspirin, which shows synergistic anti-tumor efficacy .

Experimental approaches to develop SLC25A51-targeting therapeutics:

  • Structure-based drug design targeting the substrate binding site

  • High-throughput screening for novel inhibitors

  • Validation of target engagement using cellular thermal shift assays

  • Assessment of metabolic effects using metabolomics

  • In vivo efficacy testing in xenograft models

What methods can be used to screen for and validate SLC25A51 inhibitors?

Primary screening approaches:

  • In silico docking studies based on homology models

  • Biochemical assays with purified SLC25A51 protein

  • Cell-based phenotypic screens measuring mitochondrial NAD+ levels

  • Thermal shift assays to identify direct binding compounds

Validation strategies:

  • Direct binding assays with recombinant SLC25A51

  • Mitochondrial NAD+ transport assays

  • Effects on mitochondrial protein acetylation

  • Respiratory capacity measurements

  • Metabolomic profiling

  • Comparison with genetic knockdown/knockout models

  • Selectivity profiling against related transporters

Target engagement markers:

  • Mitochondrial NAD+ levels

  • Mitochondrial protein acetylation patterns, particularly of known SIRT3 targets

  • P5CS activity and proline biosynthesis

What are common challenges in SLC25A51 research and how can they be addressed?

Challenge 1: Distinguishing direct from indirect effects

  • Solution: Use acute inhibition or inducible knockout systems

  • Compare metabolic profiles with complementation studies

  • Employ in vitro transport assays with reconstituted systems

Challenge 2: Mitochondrial isolation quality

  • Solution: Verify mitochondrial purity through marker proteins

  • Use density gradient centrifugation for higher purity

  • Assess cytosolic contamination with appropriate markers

Challenge 3: NAD+ measurement accuracy

  • Solution: Use multiple complementary techniques (HPLC, enzymatic assays)

  • Include appropriate technical and biological controls

  • Account for potential rapid turnover with kinetic measurements

Challenge 4: Specificity of inhibitors

  • Solution: Compare with genetic models

  • Test against related transporters

  • Perform structure-activity relationship studies

How can contradictory research findings on SLC25A51 be reconciled?

When facing contradictory results:

  • Compare experimental systems:

    • Cell types may have different reliance on mitochondrial metabolism

    • Expression levels of SLC25A51 paralogs might vary

    • Genetic background could affect compensatory mechanisms

  • Examine methodological differences:

    • Knockout vs. knockdown approaches

    • Acute vs. chronic loss of function

    • Assay sensitivity and specificity

  • Consider context-dependent functions:

    • Metabolic state of the cells (glycolytic vs. oxidative)

    • NAD+ availability from different sources

    • Influence of other metabolic pathways

  • Validation strategies:

    • Rescue experiments with wild-type and mutant constructs

    • Use orthogonal approaches to measure the same parameter

    • Cross-validate in different cell types or model organisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.