Recombinant Human Mitochondrial glutamate carrier 2 (SLC25A18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
SLC25A18; GC2; Mitochondrial glutamate carrier 2; GC-2; Glutamate/H(+ symporter 2; Solute carrier family 25 member 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC25A18
Target Protein Sequence
MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEG FFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVT CPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLA GLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSGCVAGSIAAVAVT PLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQG VYFIGIGERILKCFD
Uniprot No.

Target Background

Function
This protein plays a crucial role in the transport of glutamate across the inner mitochondrial membrane. The process involves co-transport with H+ ions.
Gene References Into Functions
  1. The genes CECR2, SLC25A18 and ATP6V1E1, located within the critical region for cat eye syndrome (CES), may contribute to anorectal, renal and preauricular anomalies in patients with CES. PMID: 22395867
Database Links

HGNC: 10988

OMIM: 609303

KEGG: hsa:83733

STRING: 9606.ENSP00000329033

UniGene: Hs.282982

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A18 and what is its primary function in mitochondria?

SLC25A18, also known as GC2 (Glutamate Carrier 2), belongs to the mitochondrial carrier family (MCF/SLC25) and facilitates the transport of glutamate across the inner mitochondrial membrane. It functions as a symporter, coupling glutamate transport with proton movement to maintain mitochondrial pH and ionic balance . This transporter is essential for nitrogen metabolism and mitochondrial function, particularly in the central nervous system.

The protein contains approximately 315 amino acids with a calculated molecular weight of 34 kDa, though it typically appears at 32-35 kDa in experimental systems . Like other mitochondrial carriers, it likely has the characteristic three-repeat structure with six transmembrane domains that form the substrate translocation pathway.

How does SLC25A18 differ from other mitochondrial glutamate carriers?

CharacteristicSLC25A18 (GC2)SLC25A12/13 (AGC1/2)
N-terminal domainStandard sizeExtended (~300 residues)
Ca²⁺ regulationNot directly Ca²⁺-sensitiveContains EF-hand Ca²⁺-binding motifs
Transport modeGlutamate/H⁺ symport or glutamate/OH⁻ exchangeAspartate/glutamate exchange
Metabolic rolePrimarily glutamate transportComponent of malate-aspartate shuttle

AGC1 and AGC2 are regulated by cytosolic Ca²⁺ concentration, which binds to EF-hand motifs in their N-terminal regulatory domains . In contrast, SLC25A18 lacks these structural features and operates through different regulatory mechanisms.

What is the tissue distribution pattern of SLC25A18?

SLC25A18 exhibits a tissue-specific expression pattern that aligns with its functional roles:

TissueExpression Level
BrainHigh
LiverHigh
TestisHigh
BreastLow
LungLow
ColonLow

This expression pattern supports its involvement in specialized metabolic processes in neurons and metabolically active tissues . Within the brain, immunohistochemical studies have shown SLC25A18 immunoreactivity in neuronal outlines, confirming its presence in these cells .

What are the validated methods for detecting endogenous SLC25A18 in experimental systems?

Several validated techniques are available for SLC25A18 detection:

TechniqueValidated ApplicationsNotes
Western blotMouse liver, kidney, heart, brain; human cell lines32-35 kDa band observed
ImmunoprecipitationMouse brain tissueEffective for protein interaction studies
ImmunohistochemistryMouse and rat brain tissueAntigen retrieval with TE buffer pH 9.0 recommended
ImmunofluorescenceRat striatumNeuronal outlines visualized

For antibody-based detection, specificity can be confirmed using blocking peptides, such as the peptide corresponding to amino acid residues 95-110 of mouse SLC25A18 . When selecting antibodies, researchers should consider those raised against intracellular epitopes, as the protein's functional domains are accessible from the matrix side of the inner mitochondrial membrane.

What expression systems are suitable for producing recombinant SLC25A18?

When expressing recombinant SLC25A18, researchers should consider these systems based on experimental goals:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, low costLacks post-translational modificationsStructural studies, antibody production
Yeast (S. cerevisiae)Eukaryotic processing, scalableSome mammalian modifications absentFunctional studies, protein purification
Insect cellsHigher expression of membrane proteinsMore complex systemStructural biology, functional assays
Mammalian cellsNative-like modifications and foldingLower yield, higher costInteraction studies, cellular localization

When using heterologous expression systems, verifying proper mitochondrial targeting is essential, as mislocalization can affect functional studies. For mammalian expression, human cell lines like U-87 MG (glioblastoma) and SH-SY5Y (neuroblastoma) have been successfully used to study SLC25A18 .

How can transport activity of SLC25A18 be measured in experimental systems?

Measuring the transport activity of SLC25A18 requires specialized approaches:

  • Reconstitution into liposomes: Purified SLC25A18 can be incorporated into artificial lipid bilayers to directly measure glutamate transport using radioisotope-labeled substrates or fluorescent probes.

  • Isolated mitochondria assays: Measuring glutamate uptake in isolated mitochondria from tissues or cells expressing SLC25A18, with careful controls to distinguish from other transporters.

  • Indirect cellular measurements: Monitoring changes in mitochondrial membrane potential, matrix pH, or glutamate-dependent metabolic processes.

  • Electrophysiological approaches: Patch-clamp of mitoplasts (mitochondria with outer membrane removed) can provide direct electrical measurements of transport activity.

The transport kinetics parameters reported for mitochondrial glutamate carriers include Km values in the sub-millimolar range, similar to what has been observed for aspartate/glutamate carriers (AGC1 and AGC2) which have Km values of approximately 0.2 mM for glutamate uptake .

What are the primary physiological roles of SLC25A18 in cellular metabolism?

SLC25A18 contributes to several critical metabolic pathways:

  • Nitrogen metabolism: By transporting glutamate into mitochondria, SLC25A18 facilitates the incorporation of ammonia into amino acids through glutamate dehydrogenase and glutamine synthetase pathways.

  • Neurotransmitter recycling: In the brain, it supports the glutamate-glutamine cycle between neurons and astrocytes, essential for maintaining neurotransmission.

  • Mitochondrial pH regulation: Through its proton symport activity, SLC25A18 contributes to mitochondrial pH homeostasis.

  • Bioenergetics support: By providing substrates for the TCA cycle through glutamate, which can be converted to α-ketoglutarate, SLC25A18 indirectly supports oxidative phosphorylation.

These functions make SLC25A18 particularly important in tissues with high energy demands and active nitrogen metabolism, explaining its abundant expression in brain and liver tissues .

What factors influence SLC25A18 protein function and stability?

Several factors can modulate SLC25A18 activity at the protein level:

  • Mitochondrial membrane potential: As with other mitochondrial carriers, the electrical gradient across the inner membrane provides the driving force for transport.

  • Substrate availability: Cytosolic glutamate concentrations affect transport rates according to enzyme kinetics principles.

  • pH gradients: As a proton symporter, SLC25A18 function is influenced by both matrix and intermembrane space pH.

  • Post-translational modifications: While specific modifications for SLC25A18 are not well-characterized, mitochondrial carriers can be regulated by phosphorylation, acetylation, and oxidative modifications.

  • Protein-protein interactions: Association with other mitochondrial proteins may regulate carrier function or stability.

What evidence links SLC25A18 to cancer progression and metabolism?

Recent research has uncovered important connections between SLC25A18 and cancer biology:

Studies have shown that SLC25A18 has prognostic value in colorectal cancer, with altered expression correlating with clinical outcomes . Mechanistically, overexpression of SLC25A18 results in decreased expression of β-catenin and enzymes that activate the Warburg effect .

This suggests that SLC25A18 may function as a metabolic regulator that opposes the characteristic shift to aerobic glycolysis (Warburg effect) seen in many cancers. The connection to β-catenin further implies potential crosstalk with Wnt signaling pathways, which are frequently dysregulated in colorectal cancers.

Bioinformatic analyses of Cancer Genome Atlas (TCGA) and Gene Expression Omnibus (GEO) databases have identified correlations between SLC25A18 expression and clinicopathological characteristics in multiple cancer types .

How does SLC25A18 relate to neurological function and neurological disorders?

Given its high expression in the brain, SLC25A18 likely plays important roles in neurological function:

  • Glutamate metabolism: By transporting glutamate into mitochondria, SLC25A18 supports the glutamate-glutamine cycle crucial for neurotransmission.

  • Neuronal energy metabolism: Proper glutamate transport is essential for maintaining energy production in neurons.

  • pH homeostasis: SLC25A18's proton symport activity contributes to maintaining optimal conditions for neuronal function.

While specific SLC25A18 mutations have not been widely reported in neurological disorders, the related carrier AGC1 (SLC25A12) has mutations associated with neurodevelopmental conditions characterized by hypomyelination, developmental delay, and reduced N-acetyl-aspartate in the brain . This suggests that disruptions to mitochondrial amino acid transport can have significant neurological consequences.

Immunohistochemical studies have demonstrated SLC25A18 immunoreactivity in neuronal outlines within rat striatum, confirming its expression in these critical cells .

What potential therapeutic applications might target SLC25A18?

Based on current understanding, several therapeutic strategies targeting SLC25A18 could be explored:

  • Cancer metabolism: Modulating SLC25A18 activity could potentially counter the Warburg effect in tumors, perhaps in combination with other metabolic interventions.

  • Prognostic biomarker: SLC25A18 expression patterns could be developed as a biomarker for patient stratification in colorectal cancer and potentially other malignancies .

  • Neurological disorders: For conditions involving glutamate excitotoxicity or dysregulated mitochondrial function, SLC25A18 modulation might prove therapeutic.

  • Indirect targeting: Therapeutics that enhance CREB activity or increase intracellular Ca²⁺ signaling might upregulate SLC25A18 expression, potentially beneficial in conditions with reduced carrier function .

These approaches require further validation through preclinical models before clinical translation can be considered.

How do SLC25A18 and SLC25A22 functionally complement each other in different tissues?

An important area for future research is understanding the complementary roles of the two mitochondrial glutamate carriers:

  • Tissue-specific expression: While both carriers transport glutamate, their different expression patterns suggest tissue-specific functions that need further characterization.

  • Kinetic differences: Detailed comparative studies of transport kinetics could reveal specialized roles in different cellular contexts.

  • Compensatory mechanisms: Research using knockout models could determine whether these carriers can compensate for each other's loss in different tissues.

  • Evolutionary conservation: Phylogenetic analysis could provide insights into their specialized functions across species.

What are the molecular determinants of substrate specificity in SLC25A18?

Understanding the structure-function relationship of SLC25A18 remains an important research frontier:

  • Key residues: Identifying specific amino acids that determine substrate binding and specificity through mutagenesis studies.

  • Transport mechanism: Elucidating whether SLC25A18 follows an alternating access mechanism like other mitochondrial carriers.

  • Regulatory sites: Locating binding sites for potential allosteric regulators that could modulate transport activity.

  • Structural studies: High-resolution structural determination through crystallography or cryo-EM would significantly advance our understanding.

The contact points identified in related carriers like AGC1 and AGC2, which contain specific motifs for substrate binding, could provide valuable comparative insights for SLC25A18 functional studies .

How does SLC25A18 integrate with broader cellular signaling networks?

The integration of SLC25A18 into cellular signaling networks represents an exciting area for investigation:

  • Metabolic sensing: Determining whether SLC25A18 activity responds to cellular energy status or metabolic stress.

  • Retrograde signaling: Investigating if changes in SLC25A18 function trigger signals from mitochondria to the nucleus.

  • Cancer pathway interactions: Further characterizing the relationship between SLC25A18, β-catenin, and Warburg effect enzymes .

  • Tissue-specific regulatory networks: Identifying tissue-specific factors that regulate SLC25A18 expression and function.

This systems biology approach could reveal new roles for SLC25A18 beyond its primary transport function and identify potential points for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.