Recombinant Human Mitochondrial inner membrane protease subunit 2 (IMMP2L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Mitochondrial Inner Membrane Protease Subunit 2 (IMMP2L)

Recombinant Human Mitochondrial Inner Membrane Protease Subunit 2 (IMMP2L) is a critical component of the mitochondrial inner membrane peptidase (IMMP) complex . The IMMP complex is a heterodimer responsible for cleaving signal peptides from precursor proteins transported into the mitochondrial intermembrane space . IMMP2L is essential for the proper functioning of mitochondria, which are vital organelles responsible for energy production and cellular metabolism .

Role and Function of IMMP2L

IMMP2L plays a crucial role in processing proteins within the mitochondria . Specifically, it cleaves the mitochondrial targeting signals of proteins like cytochrome c1 (Cyc1) and mitochondrial glycerol phosphate dehydrogenase 2 (Gpd2) . Cyc1 is a component of Complex III in the mitochondrial respiratory chain, while Gpd2 is a key enzyme in the glycerol phosphate shuttle, which facilitates the transfer of electrons from the cytosol to the mitochondrial respiratory chain . Proper cleavage by IMMP2L is necessary for the correct localization and function of these proteins .

Impact of IMMP2L Deficiency

Deficiency or mutation in the IMMP2L gene can lead to various cellular and physiological abnormalities . Studies using knockout mouse models have provided insights into the consequences of IMMP2L dysfunction.

4.1. Effects on Mitochondrial Respiration

Research indicates that a knockout of IMMP2L in mice leads to a decrease in total respiration . Primary mouse embryonic fibroblast (MEF) cell lines derived from the Immp2l knockout mouse displayed a roughly 27% decrease in total respiration, including a roughly 50% decrease in nonmitochondrial respiration (NMR) and a roughly 12% decrease in total mitochondrial respiration .

4.2. Impact on Gpd2 Structure and Function

IMMP2L enhances the structure and function of mitochondrial Gpd2 dehydrogenase . Studies using AlphaFold2-Multimer predictive alignment error (PAE) plots suggest that IMMP2L is crucial for the proper cleavage and function of Gpd2 .

4.3. Organ and Body Composition Analysis

Experiments on IMMP2L knockout mice revealed a significant reduction in the size of various organs and a decrease in lean body mass .

Clinical Significance and Mutations in Cancer

The IMMP2L gene is implicated in various physiological processes, and its mutations are associated with several diseases .
IMMP2L has been identified as a gene with somatic mutations in cancer .

Future Directions

Further research is needed to fully elucidate the mechanisms by which IMMP2L regulates mitochondrial function and cellular metabolism. Future studies should focus on:

  • Investigating the role of IMMP2L in different tissues and cell types.

  • Identifying additional substrates and interacting proteins of IMMP2L.

  • Exploring the therapeutic potential of targeting IMMP2L in mitochondrial disorders and cancer.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
IMMP2L; Mitochondrial inner membrane protease subunit 2; IMP2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
IMMP2L
Target Protein Sequence
MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVL LNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQKLESVLPPERLPVQREEE
Uniprot No.

Target Background

Function
This enzyme catalyzes the removal of transit peptides, essential for targeting proteins from the mitochondrial matrix, across the inner membrane, and into the intermembrane space. It is known to process the nuclear-encoded protein DIABLO.
Gene References Into Functions

Relevant Research and Gene References:

  1. A meta-analysis found no significant association (P > 0.05) between IMMP2L deletions and autism spectrum disorder (ASD), despite observing non-recurrent breakpoints in IMMP2L deletions. Common exonic deletions impacting IMMP2L were also found in a control cohort (5,971 samples) screened for psychiatric conditions. PMID: 29152845
  2. Data suggests that deletions involving the IMMP2L gene may contribute to the development of certain cognitive/behavioral disorders. PMID: 29788020
  3. IMMP2L deficiency in cells cultured under hypoxic and high-glucose conditions exacerbated neuronal death. PMID: 28316022
  4. Chromosomal breakpoints involving the IMMP2L gene in 7q31 are associated with diffuse large B-cell lymphomas. PMID: 27356265
  5. IMMP2L transcription requires topoisomerase I in human primary astrocytes. PMID: 27932244
  6. Genomic rearrangements affecting IMMP2L may be a predisposing factor in Tourette syndrome and overlapping neurodevelopmental disorders. PMID: 24549057
  7. AUTS1/AUTS5 linkage to IMMP2L-DOCK4 may be involved in autism susceptibility. PMID: 19401682
Database Links

HGNC: 14598

OMIM: 137580

KEGG: hsa:83943

STRING: 9606.ENSP00000329553

UniGene: Hs.655722

Involvement In Disease
Gilles de la Tourette syndrome (GTS)
Protein Families
Peptidase S26 family, IMP2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in all tissues tested except adult liver and lung.

Q&A

What is IMMP2L and what is its primary function in mitochondria?

IMMP2L is a subunit of the mitochondrial inner membrane peptidase complex that catalyzes the removal of transit peptides required for targeting proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space . It forms part of a heterodimer complex with IMMP1L and is exclusively located in the mitochondrial inner membrane, where it cleaves intermembrane space-sorting signals from precursor or intermediate polypeptides after they reach the inner membrane or the intermembrane space . This processing is essential for the proper functioning of its substrate proteins, including apoptosis-inducing factor (AIF) and Smac/DIABLO, which are critical for cellular homeostasis .

What are the known substrates of IMMP2L?

IMMP2L has several confirmed substrates:

  • Cytochrome c1 (CYC1): A key component of the respiratory electron transport chain

  • Mitochondrial glycerol phosphate dehydrogenase 2 (GPD2): Involved in the glycerol phosphate shuttle that transfers electrons to the mitochondrial respiratory chain

  • DIABLO (Smac): A protein involved in apoptosis regulation

Unlike conventional N-terminal processing, IMMP2L has been shown to perform C-terminal processing in the case of Mgr2 (a TIM23 complex subunit), revealing a novel mechanism in mitochondrial inner membrane biogenesis .

What are the recommended approaches for studying IMMP2L function in cellular models?

To study IMMP2L function, researchers typically use the following methodologies:

  • Gene knockdown/knockout models: IMMP2L knockdown in cellular models can be achieved through:

    • CRISPR interference (CRISPRi) systems using catalytically dead Cas9 fused to a transcriptional repressor domain (KRAB) directed by single guide RNAs

    • Traditional RNA interference methods

    • Mouse models with mutated IMMP2L (Immp2l Tg(Tyr)979Ove) have been developed to study systemic effects

  • Protein processing assays: To study IMMP2L's peptidase activity:

    • Immunoblotting to detect changes in molecular weight of substrate proteins (e.g., Mgr2 processing)

    • Mass spectrometric analysis to identify processed peptides and cleavage sites

  • Functional assessments: Measuring consequences of IMMP2L dysfunction:

    • Mitochondrial ROS detection assays to measure superoxide production

    • Native gel electrophoresis to assess changes in protein complex formation (e.g., TIM23SORT complex)

How can researchers detect and measure IMMP2L-dependent processing of target proteins?

Detecting IMMP2L-dependent processing requires multiple complementary approaches:

  • Comparative SDS-PAGE analysis: Compare the molecular weight of potential substrate proteins in wild-type versus IMMP2L-deficient cells. For example, the TIM23 complex showed altered mobility on native gels in mitochondria lacking the IMP subunit Imp1 .

  • Mass spectrometry: This technique is crucial for precisely mapping the cleavage sites and identifying processed regions. For instance, mass spectrometric analysis of mature Mgr2 identified peptides including residues 2-20 and 59-78, indicating that processing occurs at the C-terminus rather than the expected N-terminus .

  • Antibody-based detection: Develop antibodies against specific regions of substrate proteins to distinguish between processed and unprocessed forms. For Mgr2, an antiserum raised against residues 5-20 recognized the mature protein, confirming that N-terminal processing did not occur .

  • Mitochondrial fractionation: Isolate pure mitochondrial fractions to examine substrate processing in its native environment and compare with other cellular compartments to track protein localization and processing.

How does IMMP2L dysfunction contribute to age-associated disorders?

IMMP2L dysfunction leads to a cascade of cellular events that accelerate aging processes:

  • Elevated ROS production: Mitochondria from IMMP2L mutant mice generate excessive superoxide ions, leading to increased oxidative stress in multiple organs including brain and kidney . This occurs despite compensatory upregulation of superoxide dismutases in these tissues .

  • Age-associated phenotypes: IMMP2L mutant mice develop multiple aging-associated conditions including:

    • Wasting syndrome

    • Sarcopenia (muscle loss)

    • Subcutaneous fat depletion

    • Kyphosis (spinal curvature)

    • Ataxia (impaired coordination)

  • Sexual dimorphism in disease progression: Female mutants show earlier onset and more severe age-associated disorders compared to male mutants .

  • Adult stem cell impairment: Adipose-derived stromal cells (ADSCs) from mutant mice demonstrate:

    • Impaired proliferation capability

    • Reduced colony formation

    • Smaller colony size

    • Increased oxidative stress

These findings suggest that mitochondrial ROS acts as a driving force for accelerated aging, with ROS damage to adult stem cells potentially serving as a key mechanism for age-associated disorders .

What is the relationship between IMMP2L mutations and neurodevelopmental disorders?

IMMP2L has been implicated in several neurodevelopmental conditions:

How does IMMP2L-mediated processing affect mitochondrial protein complex assembly?

IMMP2L-mediated proteolytic processing has significant impacts on mitochondrial protein complex assembly:

  • TIM23 complex regulation: The TIM23 complex (presequence translocase of inner mitochondrial membrane) is essential for importing cleavable preproteins into mitochondria. Research has revealed that:

    • TIM23 complex is altered in mitochondria lacking Imp1 (an IMP subunit) despite none of its components containing a bipartite presequence

    • The TIM23 subunit Mgr2 undergoes C-terminal processing by IMP without prior cleavage by MPP (mitochondrial processing peptidase)

    • This C-terminal sequence acts as a targeting sequence but impairs stable assembly and function of the mature TIM23 complex if not removed

    • IMP removes this C-terminal targeting sequence, promoting proper assembly of the TIM23 complex

  • Novel processing mechanism: This reveals an entirely new mechanism in mitochondrial inner membrane biogenesis - C-terminal processing - which differs from the conventional N-terminal processing typically observed for mitochondrial preproteins .

What are the unique challenges in studying IMMP2L enzymatic activity in vitro?

Studying IMMP2L enzymatic activity in vitro presents several challenges:

  • Complex formation requirements: IMMP2L functions as part of a heterodimer with IMMP1L , requiring reconstitution of the complete complex for accurate assessment of enzymatic activity.

  • Membrane-associated activity: As an inner membrane protein, IMMP2L's activity is influenced by the lipid environment, necessitating appropriate membrane mimetics or detergent systems for in vitro studies.

  • Substrate specificity determination: IMMP2L processes diverse substrates (GPD2, CYC1, DIABLO) with potentially different recognition motifs, making it challenging to define consensus sequences for activity assays.

  • Distinguishing from other mitochondrial proteases: Multiple proteolytic systems operate in mitochondria including MPP, Oct1, Pcp1, m-AAA protease, i-AAA protease, and oligopeptidases . Experimental designs must rule out the involvement of these other proteases through appropriate controls.

  • Non-conventional processing: Unlike typical N-terminal processing by mitochondrial peptidases, IMMP2L can perform C-terminal processing (as seen with Mgr2) , requiring specialized detection methods for measuring this activity.

How does IMMP2L influence mitochondrial dynamics and respiratory functions?

Recent research has revealed IMMP2L's multifaceted influence on mitochondrial functions:

  • Enzyme structure and activity modulation: IMMP2L does more than just cleave transit peptides - it actively enhances the structure and function of mitochondrial GPD2. This suggests that IMMP2L's peptidase activity may activate or alter the functional properties of its substrate proteins rather than simply removing targeting sequences .

  • Oxidative stress regulation: Mitochondria from IMMP2L mutant mice generate elevated levels of superoxide, indicating that proper processing of its substrate proteins is essential for controlling ROS production . This links IMMP2L function directly to oxidative stress management within cells.

  • NAD+ biosynthesis: IMMP2L has been implicated in NAD+ biosynthesis pathways, suggesting broader metabolic roles beyond protein processing .

  • Mitochondrial size and dynamics: Recent findings indicate that IMMP2L influences mitochondrial size and dynamics, potentially through its effects on key respiratory proteins .

What are the current contradictions or knowledge gaps in IMMP2L research?

Several important knowledge gaps and contradictions exist in current IMMP2L research:

  • Cancer risk paradox: Despite increased ROS and oxidative stress (which typically increase cancer risk), IMMP2L mutant mice do not show increased tumor development . This contradicts the common association between oxidative stress and tumorigenesis.

  • Substrate recognition specificity: The molecular basis for IMMP2L's substrate recognition remains poorly understood. While it processes both GPD2 and CYC1, the common features that define IMMP2L substrates have not been fully characterized .

  • Role in integrated stress response: The relationship between IMMP2L and the integrated stress response (ISR) is still being investigated. While mitochondrial dysfunction can trigger the ISR, the specific role of IMMP2L in this pathway requires further research. One study showed that IMMP2L knockdown does not abrogate DELE1 cleavage (a component of mitochondrial stress signaling) .

  • Therapeutic potential: Despite associations with diseases including ASD, GTS, and diffuse large B-cell lymphoma , the therapeutic potential of targeting IMMP2L remains largely unexplored.

What experimental techniques are recommended for studying IMMP2L function in various disease models?

For researchers investigating IMMP2L in disease contexts, the following experimental approaches are recommended:

  • Behavioral testing in neurodevelopmental disorder models:

    • Pavlovian and instrumental learning procedures with auditory cues and food rewards

    • Response-outcome and stimulus-response association tasks

    • Pavlovian-to-instrumental transfer tests to assess stimulus-driven behavior

  • Oxidative stress assessment:

    • Tissue-specific ROS measurements

    • Quantification of oxidative damage markers (lipid peroxidation, protein carbonylation)

    • Analysis of antioxidant enzyme expression and activity

  • Adult stem cell functional analysis:

    • Proliferation assays for tissue-specific stem cells

    • Colony formation assays

    • Differentiation capacity assessment

    • Oxidative stress measurement in stem cell populations

  • Tissue-specific phenotyping:

    • EchoMRI analysis for organ and body composition

    • Assessment of lean body mass and fat distribution

    • Histological examination of affected tissues

  • Mitochondrial functional assays:

    • Respiratory capacity measurements

    • Mitochondrial dynamics assessment

    • NAD+ metabolism analysis

    • Glutathione level determination

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.