Recombinant Human Mitochondrial inner membrane protein OXA1L (OXA1L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OXA1L; Mitochondrial inner membrane protein OXA1L; Hsa; OXA1Hs; Oxidase assembly 1-like protein; OXA1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OXA1L
Target Protein Sequence
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAE
Uniprot No.

Target Background

Function

Function: Recombinant Human Mitochondrial inner membrane protein OXA1L (OXA1L) is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. It is essential for the activity and assembly of cytochrome oxidase and is required for the correct biogenesis of ATP synthase and complex I in mitochondria.

Gene References Into Functions
  1. Oxa1L-CTT undergoes conformational changes and induced oligomer formation upon ribosome binding. PMID: 20739282
  2. The structure of the C-terminal tail of human Oxa1L (Oxa1L-CTT) and its interaction with the mitochondrial ribosome has been characterized. PMID: 20601428
  3. Oxa1 topogenesis is a cooperative event involving all five transmembrane segments (TMs). The hexapeptide GLPWWG, immediately followed by TM1, is crucial for correct Oxa1 topogenesis. PMID: 19349278
Database Links

HGNC: 8526

OMIM: 601066

KEGG: hsa:5018

STRING: 9606.ENSP00000285848

UniGene: Hs.151134

Protein Families
OXA1/ALB3/YidC family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of OXA1L in mitochondria?

OXA1L serves as the mitochondrial member of the YidC/Alb3/Oxa1 membrane protein insertase family, which catalyzes the transmembrane topology of newly synthesized membrane proteins. It plays a crucial role in the co-translational insertion of mitochondrial DNA (mtDNA)-encoded proteins into the inner mitochondrial membrane (IMM). This process is essential for the assembly and function of multiple respiratory chain complexes, particularly complexes I, IV, and V of the oxidative phosphorylation (OXPHOS) system .

Methodologically, the function of OXA1L can be assessed through:

  • Immunoprecipitation studies demonstrating its interaction with mtDNA-encoded subunits

  • Functional complementation assays in yeast Oxa1p knockout models

  • Analysis of respiratory chain complex assembly in OXA1L-depleted or mutant cells

How does OXA1L contribute to the assembly of respiratory chain complexes?

OXA1L facilitates the integration of mtDNA-encoded subunits into the inner mitochondrial membrane, which is a critical early step in the assembly of respiratory chain complexes. Research demonstrates that OXA1L is particularly important for complexes I, IV, and V .

Experimental evidence shows:

  • Depletion of OXA1L in human cells causes defects in the assembly of complexes I, IV and V

  • Similar defects are observed in Drosophila melanogaster with depleted CG6404 (the fly OXA1L orthologue)

  • Immunoprecipitation of OXA1L reveals enrichment of mtDNA-encoded subunits of complexes I, IV and V

The methodological approach to study this includes:

  • Blue Native PAGE (BN-PAGE) analysis of respiratory chain complexes

  • Western blotting for specific subunits of respiratory complexes

  • High-resolution respirometry to assess oxygen consumption

What are the consequences of OXA1L mutations in humans?

Pathogenic variants in OXA1L have been associated with a severe mitochondrial encephalopathy characterized by:

  • Hypotonia

  • Developmental delay

  • Tissue-specific combined OXPHOS deficiencies

Case study evidence showed that a patient with biallelic OXA1L variants (c.500_507dup, p.(Ser170Glnfs*18) and c.620G>T, p.(Cys207Phe)) presented with:

  • Initial diagnostic tests showing isolated complex IV deficiency in skeletal muscle

  • Neuropathology indicating isolated complex I deficiency in the central nervous system

  • Combined defects in complexes I, IV and V demonstrated by Western blotting and BN-PAGE

The pathogenicity of these variants was verified by functional complementation studies, where expression of wild-type human OXA1L in patient fibroblasts rescued the complex IV and V defects .

How can the expression and localization of OXA1L be analyzed in experimental models?

Several methodological approaches can be employed:

  • mRNA expression:

    • Quantitative PCR (qPCR) can measure transcript levels in various tissues and experimental conditions

    • RNA sequencing to analyze tissue-specific expression patterns

  • Protein expression:

    • Western blotting using specific antibodies against OXA1L

    • Tissue-specific expression analysis through immunohistochemistry

  • Subcellular localization:

    • Immunofluorescence microscopy with co-localization studies using mitochondrial markers

    • Cell fractionation followed by Western blotting

    • Electron microscopy for high-resolution localization studies

  • Model systems:

    • Human cell lines (fibroblasts, HEK293, U2OS) for in vitro studies

    • Drosophila melanogaster as an in vivo model (using the orthologue CG6404)

    • Patient-derived cells for disease-relevant studies

What mechanisms might explain the tissue-specific effects of OXA1L variants?

The tissue-specific phenotypes observed in patients with OXA1L mutations present an intriguing research question. Patient tissues show differential effects - skeletal muscle exhibited complex IV deficiency while brain tissue displayed isolated complex I deficiency .

Potential mechanisms include:

  • Differential expression of OXA1L isoforms:

    • Analysis of available mRNA expression data suggests brain tissue has the lowest relative expression of OXA1L

    • Different isoforms may have tissue-specific functions or efficiencies

  • Tissue-specific mitochondrial insertase machinery:

    • Other insertases may compensate for OXA1L deficiency in certain tissues

    • Recent research has identified distant homologues of Oxa1 in the eukaryotic endoplasmic reticulum (DUF106-related proteins WRB/Get1, EMC3, and TMCO1)

  • Tissue-specific energy demands:

    • Tissues with higher energy requirements may show different thresholds for dysfunction

    • Metabolic flux analysis can help determine tissue-specific bioenergetic requirements

Methodological approaches to investigate these mechanisms include:

  • Single-cell RNA sequencing to identify tissue-specific expression patterns of OXA1L and related insertases

  • Tissue-specific knockout models to evaluate differential dependencies on OXA1L

  • Metabolic profiling of different tissues in OXA1L-deficient models

How can mitochondrial translation and protein stability be assessed in OXA1L-deficient models?

Assessment of mitochondrial translation in OXA1L-deficient models requires specialized techniques that can distinguish between translation defects and protein stability issues.

Methodological approaches include:

  • De novo mitochondrial protein synthesis assay:

    • Cells are incubated with media lacking methionine and cysteine

    • Cytosolic translation is inhibited with emetine dihydrochloride

    • Cells are then incubated with [35S] labeled methionine and cysteine (pulse)

    • This is followed by a chase period with normal growth media containing methionine

    • The stability of newly synthesized proteins is monitored over time

  • Analysis of mitoribosomal proteins:

    • Western blotting for mitoribosomal subunits to assess ribosome integrity

    • Polysome profiling to evaluate mitoribosome assembly

  • Protein stability assessment:

    • Cycloheximide chase experiments

    • Proteasome inhibition studies

    • Pulse-chase experiments with different chase durations

Patient fibroblasts with OXA1L mutations showed normal de novo mitochondrial protein synthesis during a 1-hour pulse, but demonstrated decreased signal from newly synthesized mitochondrial proteins after an 8-hour chase. This indicates that mitoribosomes can translate efficiently, but nascent polypeptides are less stable and degrade more rapidly than in control cells .

What is the role of OXA1L in mitochondrial cristae formation and organization?

OXA1L appears to have a significant role in cristae morphogenesis and organization, which is intricately associated with functional maturation of mitochondria.

Key findings from electron microscopy and tomography studies reveal:

  • Lamellar cristae formation is associated with the gain of cytochrome c oxidase (COX) function

  • COX4 subunit is predominantly localized to organized lamellar cristae

  • Some lamellar cristae containing COX are not connected to the inner boundary membrane (IBM)

This has led to hypotheses about cristae formation mechanisms:

  • Vesicle germination process within the matrix - OXA1L may facilitate this process

  • Traditional invagination of the inner boundary membrane

OXA1L has been localized to:

  • Cristae

  • Reticular structures isolated in the matrix

  • Inner boundary membrane (IBM)

Research methodologies to explore this function include:

  • Serial-section electron tomography

  • Super-resolution microscopy

  • Correlative light and electron microscopy (CLEM)

  • Functional assays of mitochondrial morphology in OXA1L mutants or knockdowns

How does OXA1L interact with the mitoribosome during co-translational insertion?

OXA1L plays a critical role in co-translational insertion of nascent mitochondrial polypeptides into the inner membrane. Understanding the molecular details of this interaction is crucial for elucidating the mechanism of OXA1L function.

Experimental approaches to study this interaction include:

  • Proximity-based protein labeling:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to OXA1L during translation

    • Analysis of labeled proteins by mass spectrometry

  • Cryo-electron microscopy:

    • Structural analysis of OXA1L-mitoribosome complexes

    • Visualization of nascent chain insertion through the OXA1L channel

  • Cross-linking mass spectrometry:

    • Identification of specific points of contact between OXA1L and the mitoribosome

    • Mapping the interaction interface

  • Immunoprecipitation studies:

    • Pull-down of OXA1L-FLAG to identify interacting mitoribosomal proteins

    • Analysis of co-precipitated proteins by mass spectrometry or Western blotting

Research has shown that OXA1L depletion leads to decreased levels of several mitoribosomal proteins (MRPs), suggesting a complex relationship between OXA1L and the mitoribosome beyond the insertase function .

What experimental systems are most appropriate for studying OXA1L function across different species?

Different experimental systems offer unique advantages for studying OXA1L function:

SpeciesModel SystemAdvantagesLimitationsKey Applications
HumanPatient fibroblastsDisease-relevant, primary cellsLimited tissue type, senescenceDisease mechanism studies
HumanHEK293T CRISPR/Cas9Genetic manipulation, scalableTransformed cellsProtein interaction studies
HumanU2OS siRNAEasy manipulation, well-characterizedTransient knockdown onlyAcute depletion studies
DrosophilaRNAi-mediated knockdownWhole organism, developmental studiesDifferent physiologyIn vivo phenotyping
YeastOxa1p knockoutSimple system, high conservationEvolutionary distanceComplementation assays

Methodological considerations for cross-species studies:

  • Sequence conservation analysis to identify functional domains

  • Heterologous expression to test functional complementation

  • Analysis of species-specific interactors

The Drosophila model has proven particularly valuable, with depletion of CG6404 (the fly orthologue of OXA1L) causing:

  • Decreased steady-state levels of representative subunits from all OXPHOS complexes

  • Marked reduction of oxygen consumption

  • Early death (1-2 days after eclosion)

These findings demonstrate that OXA1L's role in respiratory complex assembly has been conserved during evolution .

How can OXA1L deficiency be accurately diagnosed in patients?

Diagnosis of OXA1L deficiency presents challenges due to tissue-specific effects and variable biochemical presentations. A comprehensive diagnostic approach includes:

  • Clinical evaluation:

    • Assessment for encephalopathy, hypotonia, and developmental delay

    • Family history assessment

  • Biochemical testing:

    • Respiratory chain enzyme activity measurements in multiple tissues

    • Blue Native PAGE analysis of respiratory complexes

    • Western blotting for OXA1L and respiratory chain subunits

  • Genetic testing:

    • Whole exome sequencing (WES) to identify OXA1L variants

    • Segregation analysis in family members

    • Functional validation of variants through:

      • Expression studies in patient cells

      • Rescue experiments with wild-type OXA1L

      • In silico prediction of variant pathogenicity

  • Functional validation:

    • Assessment of mitochondrial protein synthesis

    • Analysis of respiratory chain complex assembly

    • Mitochondrial respirometry

Importantly, due to tissue-specific effects, biochemical testing results can vary between tissues. For example, in the reported patient case, initial diagnostic tests showed isolated complex IV deficiency in skeletal muscle, while neuropathology indicated isolated complex I deficiency in the central nervous system .

What approaches can be used to develop therapeutic strategies for OXA1L-related disorders?

Therapeutic development for OXA1L-related disorders requires understanding the underlying disease mechanisms. Potential approaches include:

  • Gene therapy approaches:

    • AAV-mediated delivery of wild-type OXA1L

    • Gene editing to correct pathogenic variants

    • Methodological considerations:

      • Tissue-specific targeting

      • Vector design for mitochondrial protein expression

  • Small molecule screening:

    • High-throughput screens for compounds that stabilize respiratory chain complexes

    • Compounds that enhance mitochondrial biogenesis

    • Methodological approaches:

      • Patient-derived cell-based assays

      • Phenotypic screens in model organisms

  • Metabolic bypass strategies:

    • Supplementation with metabolites that bypass affected respiratory chain complexes

    • Methodological approaches:

      • Metabolic flux analysis

      • In vivo testing in animal models

  • Mitochondrial replacement therapy:

    • For prevention in families with known pathogenic variants

    • Methodological and ethical considerations

The development of patient-derived cellular models, including induced pluripotent stem cells differentiated into affected cell types (neurons, muscle cells), represents a critical methodological approach for testing therapeutic strategies .

What are the optimal protocols for expressing and purifying recombinant OXA1L for structural and functional studies?

Producing functional recombinant OXA1L presents challenges due to its multiple transmembrane domains. Optimal protocols include:

  • Expression systems:

    • Bacterial expression (E. coli)

      • Fusion tags to improve solubility (MBP, GST, SUMO)

      • Special E. coli strains optimized for membrane proteins

    • Insect cell expression (Sf9, Hi5)

      • Baculovirus expression system

      • Higher eukaryotic processing capabilities

    • Mammalian cell expression

      • HEK293 GnTI- cells for structural studies

      • Inducible expression systems

  • Purification strategies:

    • Detergent solubilization optimization

      • Mild detergents (DDM, LMNG, GDN)

      • Native lipid retention

    • Chromatography approaches

      • Affinity chromatography (His-tag, FLAG-tag)

      • Size exclusion chromatography

      • Ion exchange chromatography

  • Functional reconstitution:

    • Proteoliposome reconstitution

    • Nanodiscs for structural studies

    • Functional assays to verify activity

  • Structural biology approaches:

    • Cryo-electron microscopy

    • X-ray crystallography (challenging for membrane proteins)

    • NMR for dynamics studies of specific domains

For functional studies, the use of FLAG-tagged OXA1L has proven successful in immunoprecipitation experiments to identify interacting partners, including mtDNA-encoded subunits of complexes I, IV, and V .

How can researchers effectively assess the impact of OXA1L variants on mitochondrial function?

A comprehensive assessment of OXA1L variants requires multiple complementary approaches:

  • Cell-based functional assays:

    • Patient fibroblast analysis

    • Introduction of variants into control cells through CRISPR/Cas9

    • Rescue experiments with wild-type OXA1L

    • Methodological approach demonstrated in Thompson et al. (2018):

      • Expression of wild-type human OXA1L in patient fibroblasts rescued the complex IV and V defects

  • Biochemical assessments:

    • Blue Native PAGE analysis of respiratory chain complexes

    • In-gel activity assays

    • Oxygen consumption measurements

    • ATP production assays

    • Membrane potential assessments

  • Protein interaction studies:

    • Co-immunoprecipitation to assess interaction with mitoribosomal proteins

    • BioID or proximity labeling to identify altered interaction networks

  • Structural impact prediction:

    • In silico modeling of variant effects on protein structure

    • Molecular dynamics simulations

  • Model organism studies:

    • Introduction of equivalent mutations in Drosophila CG6404

    • Assessment of phenotypic effects in vivo

The combined use of these approaches provides a comprehensive understanding of how specific variants affect OXA1L function and mitochondrial physiology .

What emerging technologies could advance our understanding of OXA1L function?

Several cutting-edge technologies show promise for elucidating OXA1L function:

  • Cryo-electron tomography:

    • Visualization of OXA1L in its native membrane environment

    • 3D reconstruction of OXA1L-mitoribosome complexes during translation

  • Single-molecule techniques:

    • FRET-based approaches to study conformational changes during insertion

    • Optical tweezers to measure forces during protein translocation

  • Advanced genetic approaches:

    • Base editing and prime editing for precise mutation introduction

    • CRISPR interference for tissue-specific and inducible knockdown

  • Mitochondria-targeted transcriptomics and proteomics:

    • MitoTag for tissue-specific isolation of mitochondria

    • Spatial transcriptomics to study regional differences in expression

  • Live-cell imaging:

    • Super-resolution microscopy of tagged OXA1L

    • Real-time visualization of nascent chain insertion

These technologies will help address fundamental questions about the molecular mechanism of OXA1L-mediated insertion and tissue-specific functions .

What are the broader implications of OXA1L research for understanding mitochondrial disease mechanisms?

Research on OXA1L provides insights into fundamental aspects of mitochondrial biology with broader implications:

  • Membrane protein insertion mechanisms:

    • Understanding general principles of co-translational insertion

    • Identifying shared mechanisms across organelles

  • Mitochondrial disease heterogeneity:

    • Explaining tissue-specific manifestations of mitochondrial disorders

    • Identifying factors that influence disease penetrance and expressivity

  • Evolutionary aspects of mitochondrial biology:

    • Conservation of insertion mechanisms across species

    • Adaptation of mitochondrial assembly processes

  • Therapeutic target identification:

    • Pathways that could be modulated to enhance respiratory chain assembly

    • Compensatory mechanisms that could be therapeutically exploited

  • Aging and neurodegeneration connections:

    • Role of mitochondrial protein insertion efficiency in aging

    • Potential contributions to neurodegenerative diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.