Recombinant Human Mitochondrial inner membrane protein (IMMT)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Human Mitochondrial inner membrane protein (IMMT) is a laboratory-produced version of the naturally occurring IMMT protein found in the inner mitochondrial membrane. IMMT functions primarily at cristae junctions, which are the narrow neck-like structures that connect the cristae membranes to the inner boundary membrane of mitochondria. These junctions are partially closed by transmembrane protein complexes that bind head to head and link opposing crista membranes in a bottleneck-like fashion . As a recombinant protein, IMMT is produced using molecular biology techniques to enable detailed study of its properties and functions outside the cellular environment, similar to approaches used with other mitochondrial proteins like LETM1 .

The importance of IMMT is highlighted by studies showing that its deletion leads to dramatically aberrant inner membrane structures, which form concentric stacks instead of the typical invaginations characteristic of normal mitochondria . This structural disruption is accompanied by reduced inner membrane potential and impaired cellular growth, indicating IMMT's essential role in maintaining both mitochondrial structure and function .

Anatomical Organization

The inner mitochondrial membrane (IMM) represents a complex biological interface that separates the mitochondrial matrix from the intermembrane space . Unlike the outer mitochondrial membrane, the IMM has an extensively folded and compartmentalized structure. Its numerous invaginations, known as cristae, significantly increase the total membrane surface area compared to a smooth inner membrane, thereby expanding the available working space for oxidative phosphorylation .

For typical liver mitochondria, the area of the inner membrane is approximately five times larger than the outer membrane due to cristae formation. This ratio varies based on cellular energy demands, with cells requiring more ATP (such as muscle cells) exhibiting even more pronounced cristae development . The cristae membranes are studded with F1 particles on the matrix side, which serve as sites for proton-gradient driven ATP synthesis .

Cristae Junction Architecture

Cristae and inner boundary membranes are separated by specialized structures called cristae junctions. These junctions feature a characteristic bottleneck morphology formed by transmembrane protein complexes that connect opposing crista membranes . IMMT represents a key component of these junctional complexes, playing a crucial role in maintaining their structure and function.

Role in Membrane Organization

IMMT functions as a critical organizer of mitochondrial cristae morphology, making it indispensable for normal mitochondrial function . Research demonstrates that IMMT deficiency in HeLa cells leads to dramatically altered inner membrane organization. Instead of forming the typical tubular or vesicular cristae structures, the inner membranes organize into closely packed stacks of membrane sheets that fuse intermittently, creating a complex maze-like membranous network .

Electron microscopic tomography studies have revealed that IMMT deficiency results in a substantial increase in the inner-to-outer membrane ratio. Notably, no cristae junctions were detected in IMMT-deficient cells, underscoring the protein's essential role in forming and maintaining these specialized structures .

Impact on Mitochondrial Function

The structural alterations resulting from IMMT deficiency have profound functional consequences. Studies show that downregulation of IMMT leads to decreased cellular proliferation and increased apoptosis, suggesting compromised mitochondrial function . Additionally, IMMT-deficient mitochondria exhibit increased reactive oxygen species (ROS) production and altered membrane potential .

An intriguing finding is that while metabolic flux increases in IMMT-deficient cells, mitochondrial oxidative phosphorylation does not increase proportionally . This discrepancy suggests that the structural organization maintained by IMMT is critical for coupling membrane architecture with bioenergetic efficiency.

Expression Systems and Purification

While specific information on recombinant IMMT production is limited in the available data, insights can be gained from approaches used with other mitochondrial inner membrane proteins like LETM1. Such recombinant proteins are typically expressed in systems capable of efficiently producing mitochondrial inner membrane proteins, such as silkworms . Purification generally involves solubilization with detergents under specific salt conditions, followed by affinity column chromatography .

The production of recombinant mitochondrial proteins like IMMT typically requires removing the mitochondrial targeting sequence (MTS) and adding affinity tags to facilitate purification . These methodological considerations are crucial for obtaining functional recombinant proteins for in vitro studies.

In Vitro Reconstitution Studies

Recombinant mitochondrial membrane proteins can be reconstituted into artificial liposome systems to study their functions in a controlled environment. For example, LETM1 recombinant protein has been shown to facilitate the formation of invaginated membrane structures in giant artificial liposomes in vitro . Similar approaches could theoretically be applied to study IMMT's role in cristae junction formation and maintenance.

Such in vitro reconstitution systems provide valuable tools for investigating the direct effects of mitochondrial proteins on membrane morphology, independent of other cellular factors that might influence these processes in vivo.

Cellular Effects of IMMT Deficiency

The table below summarizes the key cellular and mitochondrial alterations observed in response to IMMT deficiency:

ParameterNormal IMMT FunctionIMMT Deficiency
Cristae MorphologyTubular or vesicular cristae with defined junctionsClosely packed membrane sheets forming a maze-like network
Cristae JunctionsPresent and well-definedAbsent
Inner:Outer Membrane RatioNormalSubstantially increased
Cell ProliferationNormalDecreased
ApoptosisBaseline levelsIncreased
ROS ProductionNormal levelsElevated
Membrane PotentialNormalAltered
Metabolic FluxBalanced with oxidative phosphorylationIncreased but uncoupled from oxidative phosphorylation

This compilation of research findings demonstrates the multifaceted impact of IMMT on both mitochondrial structure and cellular homeostasis .

Inner Membrane Protein Import Pathways

The inner membrane of mitochondria contains hundreds of different integral membrane proteins that perform diverse functions, including molecule transport, catalytic reactions, and biogenesis or degradation of mitochondrial constituents . Most of these proteins are encoded by nuclear genes and synthesized in the cytosol, necessitating sophisticated import mechanisms .

Three distinct import routes direct proteins into the inner membrane: (1) arrest at the TIM23 inner membrane translocase followed by lateral insertion, (2) complete translocation through TIM23 into the matrix followed by export-like insertion into the inner membrane, and (3) insertion of carrier proteins via the specialized TIM22 translocase from the intermembrane space .

Relationship with Fission and Fusion Machinery

Mitochondria undergo continuous fission and fusion, processes that are essential for maintaining mitochondrial health and function. These dynamics are regulated by a set of evolutionarily conserved large GTPases, including Dnm1/Drp1/Dlp1, Fzo1/mitofusin, and Mgm1/MspI/OPA1 .

Interestingly, studies of IMMT/mitofilin deficiency have shown that while gross mitochondrial fission and fusion appear normal, the inner membrane organization is severely disrupted . This suggests that IMMT functions predominantly in inner membrane remodeling rather than in the broader processes of mitochondrial division or fusion.

Role in Inner Membrane Remodeling

The inner membrane remodeling facilitated by IMMT appears to be distinct from but potentially coordinated with the activities of proteins like Mgm1/MspI/OPA1, which are involved in inner membrane dynamics during fusion events . Understanding how IMMT interacts with or complements these dynamics proteins represents an important area for future research, particularly in the context of developing recombinant IMMT for therapeutic applications.

Cellular Consequences of IMMT Dysfunction

Given IMMT's essential role in maintaining mitochondrial structure and function, its dysfunction has significant implications for cellular health. Research has demonstrated that IMMT deficiency leads to decreased cellular proliferation and increased apoptosis , suggesting potential involvement in conditions characterized by abnormal cell growth or premature cell death.

The increased ROS production observed in IMMT-deficient cells is particularly noteworthy, as oxidative stress is implicated in numerous pathological conditions, including neurodegenerative diseases, cardiovascular disorders, and aging-related pathologies.

Potential Therapeutic Applications

Recombinant IMMT could potentially serve as a valuable tool for research into mitochondrial disorders and the development of therapeutics targeting mitochondrial dysfunction. Similar to approaches with other mitochondrial proteins, purified recombinant IMMT might be used in screening assays to identify compounds that stabilize or enhance its function, potentially offering therapeutic benefits in conditions associated with compromised mitochondrial structure or function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
IMMT; HMP; MIC60; MINOS2; PIG4; PIG52; MICOS complex subunit MIC60; Cell proliferation-inducing gene 4/52 protein; Mitochondrial inner membrane protein; Mitofilin; p87/89
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
IMMT
Target Protein Sequence
MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGG TILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKE SKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGK PTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIA AQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE ELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHE LVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELA EQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMR TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDIN TAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIK ANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFL SYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRV AQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE
Uniprot No.

Target Background

Function
Mitochondrial inner membrane protein (IMMT) is a component of the MICOS complex, a large protein complex within the mitochondrial inner membrane. The MICOS complex plays critical roles in maintaining crista junctions, inner membrane architecture, and the formation of contact sites with the outer membrane. IMMT is essential for the stability of the MICOS complex and the preservation of mitochondrial cristae morphology.
Gene References Into Functions
  1. Sub-mitochondrial localization of the genetic-tagged mitochondrial intermembrane space-bridging components Mic19, Mic60, and Sam50. PMID: 28808085
  2. PKA-mediated phosphorylation of MIC60 negatively regulates mitochondrial clearance initiated by PINK1 and Parkin. PMID: 27153535
  3. Mitofilin-knockdown cells exhibited decreased mitochondrial membrane potential (DeltaPsim) and intracellular ATP content, while CHCHD6-knockout cells showed minimal impact on these parameters. PMID: 26530328
  4. Mic60 interacts with mtDNA and plays a role in the architecture of the mtDNA D-loop region. These findings reveal a previously unrecognized role of Mic60 in mtDNA transcription. PMID: 25612828
  5. Mitofilin, a mitochondrial protein, has been shown to be related to cardiac hypertrophy, providing insights into the role of mitochondria in this condition. PMID: 24555791
  6. Transgenic overexpression of mitofilin preserves mitochondrial structure, leading to the restoration of mitochondrial function and attenuation of cardiac contractile dysfunction in the diabetic heart. PMID: 25463274
  7. APOOL is a cardiolipin-binding component of the Mitofilin/MINOS protein complex. PMID: 23704930
  8. Mitofilin distinctly functions in mitochondrial cristae remodeling and controls cytochrome c release during apoptosis. PMID: 23058921
  9. CHCM1/CHCHD6, a novel mitochondrial protein, is linked to the regulation of mitofilin and mitochondrial cristae morphology. PMID: 22228767
  10. The mitochondrial dysfunction induced by DISC1 deficiency was partially reversed by coexpression of Mitofilin, confirming a functional link between DISC1 and Mitofilin in maintaining normal mitochondrial function. PMID: 20880836
  11. Data shows that the nuclear matrix protein matrin 3, cytoskeletal motor protein HMP, and the circadian clock protein lark were significantly decreased in fetal Down syndrome brain. PMID: 12469345
  12. Mitofilin is a critical organizer of mitochondrial cristae morphology and is thus indispensable for normal mitochondrial function. PMID: 15647377
  13. A role in protein import related to the maintenance of mitochondrial structure is suggested. Mitofilin helps regulate mitochondrial morphology, and four of the associated proteins (metaxins 1 and 2, SAM50, and CHCHD3) have been implicated in protein import. PMID: 17624330

Show More

Hide All

Database Links

HGNC: 6047

OMIM: 600378

KEGG: hsa:10989

STRING: 9606.ENSP00000387262

UniGene: Hs.148559

Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion.

Q&A

What is IMMT and what experimental approaches can confirm its localization in mitochondria?

IMMT (also known as Mitofilin) is a crucial scaffolding protein located in the inner mitochondrial membrane that maintains cristae structure. Similar to other mitochondrial proteins like TFAM, IMMT requires proper targeting signals for mitochondrial localization. Experimental confirmation of IMMT localization can be achieved through:

  • Fluorescence microscopy with mitochondrial co-localization markers

  • Subcellular fractionation followed by Western blotting

  • Protease protection assays to confirm membrane topology

  • Electron microscopy with immunogold labeling

These approaches should be used in combination to provide comprehensive evidence of proper localization. Like rhTFAM, which rapidly localizes to mitochondria in vitro, properly designed recombinant IMMT constructs should demonstrate efficient targeting to the inner membrane .

How does recombinant IMMT differ from endogenous IMMT in experimental applications?

Recombinant IMMT typically contains additional elements that may affect its behavior compared to endogenous protein:

  • Fusion tags (His, FLAG, HA) for purification and detection

  • Mitochondrial targeting sequences to enhance localization efficiency

  • Potential differences in post-translational modifications

When designing recombinant IMMT, researchers should consider incorporating a "mitochondrial transduction domain" similar to that used with rhTFAM, which combines a protein transduction domain (PTD) and mitochondrial localization signal (MLS) to ensure efficient targeting . Validation experiments should compare the behavior of recombinant and endogenous IMMT, particularly regarding cristae morphology maintenance and interactions with other MICOS components.

What expression systems are most suitable for producing functional recombinant IMMT?

The choice of expression system significantly impacts recombinant IMMT functionality:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effectiveLimited post-translational modifications, inclusion bodiesStructural studies after refolding
Insect cellsModerate yield, better foldingModerate cost, some PTM differencesProtein-protein interaction studies
Mammalian cellsNative-like PTMs, proper foldingLower yield, higher costFunctional studies, cell-based assays

For applications requiring fully functional IMMT, mammalian expression systems are preferred despite lower yields, as they provide the most physiologically relevant post-translational modifications and folding environment. This approach parallels successful strategies used with other mitochondrial proteins like rhTFAM .

How can researchers effectively design experiments to distinguish direct effects of IMMT manipulation from secondary mitochondrial adaptations?

Distinguishing direct IMMT effects from secondary adaptations requires carefully structured experimental designs:

  • Temporal profiling: Monitor changes at multiple time points (minutes, hours, days) after IMMT manipulation

  • Dose-response relationships: Test multiple concentrations of recombinant IMMT

  • Rescue experiments: Complement IMMT depletion with wild-type versus function-specific mutants

  • Acute versus chronic manipulation: Compare rapid depletion (e.g., optogenetics) with stable knockdown

  • Specific inhibitors: Use inhibitors of downstream pathways to isolate primary effects

This approach parallels strategies used with rhTFAM, where temporal analysis helped distinguish immediate effects from secondary adaptations . For IMMT, early morphological changes in cristae structure likely represent direct effects, while later bioenergetic changes may reflect secondary adaptations.

What experimental approaches can resolve contradictory findings regarding IMMT function across different model systems?

Contradictory findings about IMMT function can be systematically addressed through:

  • Standardized methodology across models:

    • Consistent protein quantification methods

    • Identical imaging parameters for cristae analysis

    • Uniform functional assays for bioenergetic assessment

  • Comparative analysis framework:

    • Direct side-by-side comparison of multiple models

    • Consistent data normalization procedures

    • Effect size calculations rather than just statistical significance

  • Variable isolation:

    • Controlling for cell type-specific factors

    • Accounting for compensatory mechanisms

    • Considering metabolic state differences

Studies with rhTFAM demonstrate how systematic experimental designs across multiple models (cell lines, primary cells, and in vivo models) can provide consistent mechanistic insights despite model-specific variations .

How do modifications to recombinant IMMT affect its functionality in experimental systems?

Modifications to recombinant IMMT can significantly impact its functionality:

  • Terminal tags: C-terminal tags generally preserve function better than N-terminal tags, which may interfere with import signals

  • Linker sequences: Flexible linkers (GGGGS repeats) minimize functional interference

  • Mutation of key residues: Site-directed mutagenesis of coiled-coil domains often disrupts function

  • Post-translational modification sites: Phosphomimetic mutations can alter IMMT interactions and function

When designing modified IMMT constructs, researchers should validate functionality through complementation studies in IMMT-depleted cells, assessing cristae morphology and mitochondrial function. Similar validation approaches have been used with other mitochondrial proteins like rhTFAM to ensure that modifications don't compromise biological activity .

What are the optimal experimental designs for testing IMMT function in cellular models?

Optimal experimental designs for IMMT functional studies should incorporate:

  • Proper controls:

    • Vehicle controls for delivery solutions

    • Inactive protein controls (e.g., denatured IMMT)

    • Non-targeting controls for genetic manipulations

  • Randomization and blinding:

    • Random assignment to treatment groups

    • Blinded analysis of imaging and functional data

    • Processing samples in random order

  • Factorial designs:

    • Testing IMMT effects across multiple cell types

    • Evaluating interactions between IMMT and stress conditions

    • Assessing IMMT function under different metabolic states

What controls are essential when studying the effects of recombinant IMMT on mitochondrial morphology and function?

Essential controls for IMMT studies include:

  • Treatment controls:

    • Vehicle-only control (buffer without protein)

    • Unrelated mitochondrial protein control

    • Heat-inactivated IMMT control

  • Genetic controls:

    • Rescue with wild-type IMMT after knockdown

    • Function-deficient IMMT mutant controls

    • Other MICOS component controls for specificity

  • Technical controls:

    • Multiple imaging fields/sections for morphology

    • Internal standards for functional assays

    • Time-matched controls for all measurements

Proper experimental controls are fundamental to establishing cause-effect relationships in IMMT research . Without appropriate controls, researchers cannot differentiate IMMT-specific effects from non-specific consequences of experimental manipulation.

How should dose-response experiments be designed to determine optimal recombinant IMMT concentrations for functional studies?

Dose-response experiments for recombinant IMMT should follow this structured approach:

  • Concentration range selection:

    • Begin with wide range (e.g., 1 nM to 1 μM)

    • Use logarithmic spacing between concentrations

    • Include concentrations above and below expected physiological levels

  • Readout selection:

    • Primary structural outcome (cristae morphology)

    • Functional outcomes (respiration, membrane potential)

    • Interaction measurements (co-IP with MICOS components)

  • Analysis framework:

    • Generate complete dose-response curves

    • Calculate EC50 values for each readout

    • Identify potential hormetic effects (beneficial at low doses, detrimental at high doses)

This systematic approach follows established experimental design principles for determining optimal treatment parameters . Studies with rhTFAM have demonstrated that mitochondrial proteins often show non-linear dose-response relationships, with optimal effects at specific concentration ranges .

What are the most effective protocols for assessing IMMT-dependent changes in cristae morphology?

Effective protocols for quantifying IMMT effects on cristae morphology include:

  • Transmission Electron Microscopy (TEM):

    • Chemical fixation: 2.5% glutaraldehyde followed by 1% osmium tetroxide

    • Section thickness: 70-80 nm for optimal visualization

    • Systematic sampling: Minimum 20 mitochondria per condition from multiple cells

    • Quantitative parameters: Cristae width, junction diameter, cristae number per mitochondrion

  • Super-resolution microscopy:

    • Sample preparation: Immunofluorescence with primary antibodies against cristae markers

    • Imaging: STED or PALM/STORM with <50 nm resolution

    • Analysis: Computer-assisted measurement of cristae dimensions

  • Tomographic reconstruction:

    • Serial sectioning TEM or focused ion beam SEM

    • 3D reconstruction of complete mitochondrial volume

    • Quantification of cristae connectivity and topology

These methods provide complementary structural information, from detailed ultrastructure (TEM) to dynamic changes in living cells (super-resolution).

What approaches can assess the functional consequences of IMMT manipulation in cellular and animal models?

Comprehensive functional assessment of IMMT manipulation requires multiple complementary approaches:

  • Bioenergetic analysis:

    • Oxygen consumption measurements (Seahorse XF, Clark electrode)

    • ATP production rates (luminescence-based assays)

    • Membrane potential assessment (TMRM, JC-1 dyes)

  • Oxidative stress evaluation:

    • ROS production (DCF-DA, MitoSOX)

    • Oxidative damage markers (protein carbonylation, lipid peroxidation)

    • Antioxidant system assessment (GSH/GSSG ratio)

  • Cell/organism-level outcomes:

    • Cell viability and growth rates

    • Stress resistance (e.g., to oxidative challenges)

    • Behavioral testing in animal models (motor function, cognition)

Studies with rhTFAM have demonstrated how comprehensive functional assessment can link molecular changes to physiologically relevant outcomes, including improved motor recovery after MPTP treatment and increased survival in endotoxin sepsis models .

How can in vivo studies of IMMT function be designed to maximize translational relevance?

Translational in vivo studies of IMMT should incorporate:

  • Delivery optimization:

    • Route selection (I.V., I.P., tissue-specific)

    • Pharmacokinetic profiling (tissue distribution, half-life)

    • Blood-brain barrier penetration assessment for neurological applications

  • Disease model selection:

    • Models with known cristae abnormalities

    • Both genetic and induced mitochondrial dysfunction models

    • Models with progressive versus acute pathology

  • Outcome measure selection:

    • Tissue-specific functional assessments

    • Behavioral/physiological outcomes

    • Survival and quality of life measures

  • Therapeutic window determination:

    • Pre-treatment (preventive) versus post-insult (therapeutic) administration

    • Multiple treatment timing points to identify optimal intervention window

This approach parallels successful in vivo studies with rhTFAM, which demonstrated improved motor recovery in the MPTP model and dose-dependent survival benefits in LPS sepsis models .

What factors should be considered when interpreting seemingly contradictory results from different IMMT experimental models?

When reconciling contradictory IMMT findings, consider:

  • Model-specific factors:

    • Cell type metabolic profiles (glycolytic vs. oxidative)

    • Tissue-specific MICOS complex composition

    • Compensation mechanisms in chronic models

  • Methodological differences:

    • Protein manipulation approach (knockout vs. knockdown vs. inhibition)

    • Dosing and timing variations

    • Readout sensitivity and specificity

  • Contextual factors:

    • Energetic demand during experiment

    • Cell cycle stage and proliferation rate

    • Experimental stress conditions

  • Integration framework:

    • Weighing evidence based on methodological strength

    • Identifying consistent patterns across conflicting results

    • Developing testable hypotheses to resolve contradictions

These considerations parallel approaches used in analyzing variable responses to rhTFAM across different experimental systems .

How can researchers distinguish between direct effects of IMMT on cristae morphology and secondary consequences for mitochondrial function?

Distinguishing primary from secondary IMMT effects requires:

  • Temporal analysis approach:

    • Ultra-rapid assessment immediately after IMMT perturbation

    • Time-course studies tracking sequence of changes

    • Correlation analysis between morphological and functional changes

  • Structure-function relationship mapping:

    • Specific IMMT mutants affecting distinct domains

    • Correlation between degree of structural change and functional impact

    • Rescue experiments with domain-specific constructs

  • Comparative MICOS component analysis:

    • Parallel manipulation of multiple MICOS proteins

    • Identification of IMMT-specific versus general MICOS effects

    • Epistasis experiments with multiple component manipulations

This methodological framework, similar to approaches used with rhTFAM to distinguish direct from indirect effects , helps establish causal relationships between IMMT's structural role and resulting functional consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.