Recombinant Human Dicarboxylate carrier SLC25A8 (UCP2)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions

UCP2 operates as an electroneutral antiporter with the following activities:

Substrates TransportedDirectionPhysiological Impact
Oxaloacetate, malateMatrix → cytosolReduces TCA cycle flux, lowers ATP/ADP ratio
Phosphate (Pi) + H⁺Cytosol → matrixModulates mitochondrial proton gradient
L-aspartate, chlorideBidirectionalSupports nucleotide synthesis and redox homeostasis

Key functional roles include:

  • Attenuating ROS production by limiting electron transport chain overactivity

  • Enabling metabolic flexibility via glutaminolysis and glycolysis regulation

  • Facilitating mitochondrial uncoupling independent of thermogenesis

Cancer Biology

Cancer TypeUCP2 RoleMechanistic Insight
Pancreatic adenocarcinomaOncogenic: Restores redox balance, promotes proliferationKO models show ↑ ROS, ↓ NADPH; rescued by UCP2 overexpression
Colorectal cancerDual role: Tumor-suppressive in normal cells, oncogenic in tumorsKO increases oxidative stress markers (↑ GSSG/GSH ratio) and tumor initiation
MelanomaPro-metastatic: Enhances OXPHOS, reduces lipid synthesisOverexpression ↑ OCR, ↓ lactate production in B16F10 cells

Metabolic Regulation

  • Glucose homeostasis: Modulates DRP1-dependent mitochondrial fission in hypothalamic neurons

  • Immune modulation: Preserves itaconate production in alternatively activated macrophages during inflammation resolution

Experimental Applications

  • Antibody validation: Used as a control fragment (100x molar excess) to confirm antibody specificity in WB/IHC

  • Metabolic flux studies: Tracks dicarboxylate transport using ¹³C-glutamine tracers

  • Therapeutic targeting: Pharmacological inhibitors (e.g., genipin) exploit UCP2’s role in chemoresistance

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8; UCPH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation from ATP synthesis. This results in energy dissipation as heat.
Gene References Into Functions

Genetic Associations and Functional Implications of UCP2:

  1. UCP3 gene variant rs1800849 showed significant association with prediabetes in a rural Chinese population, with overweight modifying the effect of UCP2 variant rs660339 on type 2 diabetes. This suggests a role for these variants in type 2 diabetes development. PMID: 29529994
  2. Studies do not support UCP2 variants as a sole cause of hyperinsulinemic hypoglycemia. PMID: 28681398
  3. Aspergillus protease-induced mitochondrial ROS production is associated with decreased UCP2 expression via TGF-beta-SMAD4 signaling, suggesting a regulatory role in mitochondrial ROS formation during fungal protease-mediated inflammation. PMID: 30007886
  4. UCP2-866 G/A polymorphism is associated with obesity. PMID: 29634487
  5. Lower UCP2 levels in peripheral blood mononuclear cells were observed in obese women with low resting energy expenditure compared to obese women with higher resting energy expenditure and normal-weight women. PMID: 29017362
  6. The UCP2-866 AA genotype was independently associated with better functional outcomes after ischemic stroke with recanalization of proximal MCA occlusion. PMID: 29043564
  7. UCP2 inhibits myointimal hyperplasia after vascular injury, possibly through suppressing NF-κB-dependent smooth muscle cell proliferation and migration. PMID: 29025747
  8. UCP2 variants rs659366 (A allele) and rs660339 (T allele) are associated with longer leukocyte telomeres in non-diabetic individuals, independent of cardiovascular risk factors. PMID: 27615599
  9. Association between nonalcoholic fatty liver disease (NAFLD) and UCP2 single nucleotide polymorphism 866G was evaluated. PMID: 27794526
  10. UCP2 influences serum urate concentration and hyperuricemia risk, with associations varying by gender and BMI. PMID: 27273589
  11. UCP2 regulates SIRT3 activity by sensing energy levels, maintaining mitochondrial homeostasis, and exhibiting a cytoprotective effect on ischemia-reperfusion injury. PMID: 28737710
  12. UCP2 mediates hypoxia-induced chemoresistance in non-small cell lung cancer cells by repressing peroxisome proliferator-activated receptor gamma. PMID: 28042952
  13. UCP variability has pleiotropic effects, influencing telomere length and glucose homeostasis, possibly through energy metabolism and stress response. PMID: 28281015
  14. UCP2 expression is associated with weight loss after hypocaloric diet intervention. PMID: 27759071
  15. Decreased UCP2 gene expression in mononuclear cells from obese and diabetic patients might contribute to immunological abnormalities, suggesting its potential role in obesity and diabetes research. PMID: 29151065
  16. UCP2 stimulates hnRNPA2/B1, GLUT1, and PKM2 expression and sensitizes pancreatic cancer cells to glycolysis inhibition. PMID: 27989750
  17. In hepatocellular carcinoma, miR-214 acts as a tumor suppressor by targeting UCP2. PMID: 27129291
  18. UCP2 inhibition induced cellular apoptosis and autophagy. PMID: 28089824
  19. UCP2 and PLIN1 gene expression influences resting metabolic rate in obese individuals and may predict weight loss after bariatric surgery. PMID: 27376365
  20. Lack of association between ECG-derived QTd and UCP2 DD suggests that gene-related QRS duration prolongation is independent of cardiac hypertrophy. PMID: 27875726
  21. Cellular feedback regulation may occur between UCP2/UCP3 and ACE, suggesting novel crosstalk and mutual regulation between cellular and endocrine metabolism. PMID: 27417115
  22. Genetic risk factors for healthy aging differ between males and females, with implications for mitochondrial function changes during aging. PMID: 26965008
  23. ADIPOQ rs2241766 polymorphism is associated with colorectal cancer (CRC) risk, with interactions between ADIPOQ rs2241766, UCP2 rs659366, FABP2 rs1799883 and red meat consumption influencing CRC risk. PMID: 23826253
  24. Metabolic syndrome components in non-alcoholic fatty liver disease (NAFLD) patients and nutritional intakes were analyzed according to UCP2 -866G/A genotype. PMID: 27301474
  25. UCP2 is a key regulator of mitochondrial redox status and lipid signaling, and hydrogen peroxide may mediate its tumor-promoting activity in skin. PMID: 28574619
  26. COL1A1, UCP2, and PRPF40A are novel genes involved in hypoxia response in non-small cell lung cancer. PMID: 28258342
  27. Effects of UCP2 polymorphisms on the brain were studied. PMID: 28771482
  28. UCP2 variants rs660339 (Ala55Val) and rs659366 (-866G>A) are associated with weight loss after Roux-en-Y gastric bypass surgery for morbid obesity. PMID: 27743836
  29. Dominant UCP2 mutations are a significant cause of congenital hyperinsulinism, with affected individuals showing hypersensitivity to glucose-induced hypoglycemia. PMID: 27967291
  30. UCP2 has an apoptotic effect on beta cells via regulation of the intrinsic apoptotic pathway in brain-dead organ donors. PMID: 28222054
  31. UCP2 SNPs rs660339 (Ala55Val) and rs659366 (-866G>A) are associated with adherence to dietary restrictions after bariatric surgery, suggesting a role in appetite regulation or satiety. PMID: 27256164
  32. The UCP2 -866 A/A genotype is associated with a significantly increased risk of presbycusis. PMID: 27562082
  33. Estrogens may increase mitochondrial reactive oxygen species production by repressing UCPs, including UCP2. PMID: 26450681
  34. UCP2 selectively modulates single-channel MCU-dependent mitochondrial Ca2+ inward current. PMID: 26275882
  35. GTPBP3 regulates UCP2 protein expression via AMPK signaling. PMID: 26642043
  36. UCP2 does not mediate palmitate-induced mitochondrial ROS generation or cell loss, but rather dampens palmitoleate protection against palmitate toxicity. PMID: 25482405
  37. UCP2 is expressed in human cumulus cells. PMID: 26356408
  38. Higher UCP2 expression correlates with a poorer prognosis in breast cancer patients. PMID: 25960046
  39. The UCP2 -866A/55Val/Ins haplotype is associated with increased diabetic kidney disease (DKD) risk and lower eGFR in type 2 diabetes patients. PMID: 26218518
  40. Ucp2-mediated engulfment of apoptotic cells involves both proton gradient dissipation and anion transfer or nucleotide binding. PMID: 26082030
  41. UCP2 overexpression decreased mitochondrial superoxide induction by gemcitabine (GEM) in an HCC cell line with low endogenous UCP2. PMID: 26181366
  42. miR133a overexpression or UCP-2 knockdown sensitized MCF-7/Dox cells to doxorubicin treatment. PMID: 26107945
  43. UCP2 gene polymorphisms may cause liver dysfunction through interaction with body fat, rather than alcohol intake. PMID: 26526553
  44. Mitochondrial UCP2 gene expression is regulated by miR-2909 and AATF in response to high glucose. PMID: 25976474
  45. The UCP2 -866 A/A genotype is associated with increased hepatic UCP2 expression and reduced nonalcoholic steatohepatitis risk, especially in subjects with normal fasting glucose. PMID: 25351290
  46. UCP2 may be involved in the pathogenesis of type 2 diabetes mellitus and diabetic retinopathy in Chinese populations. PMID: 25396419
  47. The UCP-2 exon 8 del/ins polymorphism was associated with higher obesity, insulin resistance, dyslipidemia, and lower adjusted metabolic rate. PMID: 25081806
  48. UCP2 gene polymorphism is associated with obesity and type 2 diabetes mellitus. PMID: 26402942
  49. Meta-analysis revealed significant associations between UCP2-866G/A, Ins/Del, Ala55Val and UCP3-55C/T polymorphisms and BMI. PMID: 24804925
  50. UCP2 acts as a sensor and negative regulator of mitochondrial ROS production in response to hyperglycemia. PMID: 25910810
Database Links

HGNC: 12518

OMIM: 601693

KEGG: hsa:7351

STRING: 9606.ENSP00000312029

UniGene: Hs.80658

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed in adult human tissues, including tissues rich in macrophages. Most expressed in white adipose tissue and skeletal muscle.

Q&A

What is the functional role of UCP2 in mitochondrial metabolism?

UCP2 belongs to the SLC25 family of mitochondrial carrier proteins and functions as a proton transporter across the inner mitochondrial membrane. It creates proton leaks that uncouple oxidative phosphorylation from ATP synthesis, resulting in energy dissipation as heat rather than ATP production . Unlike its more tissue-restricted family member UCP1, UCP2 is widely expressed across multiple tissues, suggesting broader physiological functions beyond thermogenesis .

UCP2's primary mechanistic action involves decreasing the proton gradient generated by the electron transport chain, which subsequently reduces reactive oxygen species (ROS) production while also lowering the efficiency of ATP generation. This function makes UCP2 a critical regulator of cellular energy homeostasis, oxidative stress, and mitochondrial function across various tissues including white adipose tissue, skeletal muscle, and cells rich in macrophages .

How can researchers verify UCP2 expression in different tissue types?

To accurately assess UCP2 expression across various tissues, researchers should employ multiple complementary techniques:

  • RT-qPCR: For quantifying UCP2 mRNA levels using validated primers specific to human UCP2 (NM_003355.2)

  • Western blotting: Using validated antibodies against human UCP2 with appropriate mitochondrial loading controls such as VDAC or TOM20

  • Immunohistochemistry/Immunofluorescence: For spatial localization within tissues

  • Single-cell RNA sequencing: To determine cell type-specific expression patterns

Reference data for baseline UCP2 expression shows highest levels in white adipose tissue and skeletal muscle, with significant expression also in lung, kidney, spleen, and heart tissues . When analyzing UCP2 expression data, researchers should note that expression patterns vary between species and can be altered in disease states such as cancer, where UCP2 expression is significantly upregulated in certain cancer types including breast cancer .

What are reliable methods for producing recombinant human UCP2 protein?

The production of functional recombinant human UCP2 requires specialized approaches to maintain the native conformation of this membrane protein:

Expression systems:

  • E. coli-based systems: Using bacterial strains optimized for membrane protein expression (C41(DE3) or C43(DE3))

  • Insect cell systems: Sf9 or High Five cells using baculovirus vectors, which often yield properly folded mitochondrial proteins

  • Mammalian cell lines: HEK293 or CHO cells for mammalian post-translational modifications

Purification strategy:

  • Cell lysis under gentle conditions

  • Solubilization with appropriate detergents (DDM, LMNG, or digitonin)

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Size exclusion chromatography for final purification

Quality control assessments:

  • Circular dichroism to verify secondary structure

  • Functional reconstitution into liposomes to confirm proton transport activity

  • Thermal stability assays to ensure proper folding

Research has shown that recombinant UCP2 retains its functional properties when properly expressed and purified, making it suitable for in vitro biochemical and biophysical studies of proton transport activity .

How do genetic variations in UCP2 impact its function and disease associations?

Genetic variations in the UCP2 gene have been linked to various metabolic phenotypes, particularly obesity and type 2 diabetes. Several important single nucleotide polymorphisms (SNPs) have been characterized:

SNP IDNucleotide/Amino Acid ChangeFrequencyAssociated Phenotypes
rs660339A55VCommonBody mass index variations, obesity risk
rs45541732R76QLess commonNot fully characterized
rs45486692R154QLess commonNot fully characterized
rs45490393A268GLess commonNot fully characterized
rs45596837S282CLess commonNot fully characterized

Notably, genetic variations in UCP2 define the body mass index quantitative trait locus 4 (BMIQ4) [MIM:607447] . A common polymorphism in the promoter region of UCP2 has been associated with decreased risk of obesity in middle-aged individuals .

When investigating these variants, researchers should consider:

  • Functional impact using in vitro assays measuring proton conductance

  • Population-specific frequency distributions

  • Gene-environment interactions, particularly with dietary factors

  • Tissue-specific effects on expression and activity

These genetic variations provide valuable insights into UCP2's physiological roles and potential as a therapeutic target for metabolic disorders .

What mechanisms regulate UCP2 expression in response to physiological stimuli?

UCP2 expression is dynamically regulated through multiple mechanisms, providing adaptive responses to various physiological conditions:

Transcriptional regulation:

  • KLF2 (Krüppel-like factor 2) directly binds to the UCP2 promoter to upregulate its transcription in endothelial cells

  • Unidirectional shear stress increases UCP2 expression while oscillatory shear stress inhibits it through altered KLF2 expression

  • Pharmacological compounds including statins and resveratrol upregulate UCP2 expression, potentially through KLF2-dependent mechanisms

Post-transcriptional regulation:

  • MicroRNAs targeting UCP2 mRNA

  • mRNA stability regulation

  • Translation efficiency control

Post-translational regulation:

  • Protein stability and degradation pathways

  • Functional regulation by specific metabolites

External modulators:

  • Proinflammatory stimuli inhibit UCP2 expression

  • Metabolic substrates (fatty acids, glutamine) can induce UCP2 expression

  • Oxidative stress conditions generally increase UCP2 expression as an adaptive response

These regulatory mechanisms allow UCP2 to respond appropriately to cellular needs, particularly in contexts requiring metabolic adaptation or protection against oxidative stress damage .

How does UCP2 influence mitochondrial ROS production and oxidative stress?

UCP2's role in regulating reactive oxygen species (ROS) production represents one of its most important physiological functions. Researchers investigating this aspect should consider the following methodological approaches:

Mechanisms of UCP2-mediated ROS regulation:

Experimental approaches to measure UCP2's impact on ROS:

  • Fluorescent probes (DCF-DA, MitoSOX) for real-time ROS detection

  • EPR spectroscopy for precise superoxide quantification

  • Mitochondrial membrane potential measurements using JC-1 or TMRM

  • Simultaneous oxygen consumption and H2O2 production measurements

  • Oxidative damage markers (protein carbonylation, lipid peroxidation)

Cell models and considerations:

  • UCP2 knockdown vs. overexpression systems

  • Inducible expression systems to avoid adaptation

  • Mitochondrial-targeted antioxidants as controls

  • Parallel assessment in multiple tissue types

Research has demonstrated that UCP2 serves as a key mitochondrial antioxidant protein that can improve endothelium-dependent relaxation in obese mice and protect against inflammation-induced damage in various tissues .

How does endothelial UCP2 regulate vascular inflammation and atherosclerosis development?

Recent research has revealed that UCP2 plays a crucial role in vascular endothelial cells and atherosclerosis protection. This represents an important emerging area for cardiovascular research:

Key mechanistic findings:

  • UCP2 expression in endothelial cells is mechanosensitive, regulated by blood flow patterns through KLF2-dependent mechanisms

  • UCP2 knockdown induces expression of genes involved in proinflammatory and profibrotic signaling pathways

  • Endothelial cell-specific Ucp2 deletion promotes atherogenesis and collagen production in mouse models

  • RNA-sequencing analysis identified FoxO1 (forkhead box protein O1) as a major proinflammatory transcriptional regulator activated by UCP2 knockdown

Research methodologies for investigating endothelial UCP2:

  • In vitro shear stress simulation systems to model blood flow patterns

  • Endothelial cell-specific Ucp2 knockout mouse models

  • Adeno-associated virus-mediated EC-specific Ucp2 overexpression

  • Disturbed flow-enhanced atherosclerosis mouse models

  • Comprehensive transcriptomic analysis following UCP2 modulation

Experimental evidence of atheroprotection:

  • Unidirectional shear stress upregulates UCP2 while oscillatory shear stress inhibits it

  • FoxO1 inhibition reduces vascular inflammation and disturbed flow-enhanced atherosclerosis

  • UCP2 deficiency aggravates while UCP2 overexpression inhibits carotid atherosclerotic plaque formation

These findings establish UCP2 as a potential therapeutic target for preventing or treating atherosclerosis, especially at arterial regions experiencing disturbed blood flow .

What role does UCP2 play in cancer progression and how can it be studied?

UCP2 has emerged as a significant factor in cancer biology, with complex and sometimes contradictory roles depending on cancer type and stage:

UCP2 expression patterns in cancer:

  • Significantly upregulated in 11 cancer types including breast cancer

  • Downregulated in 7 cancer types

  • Expression changes correlate with prognostic outcomes in several cancers

Functional roles in cancer metabolism:

  • Adaptation to altered metabolism (Warburg effect)

  • Protection against excessive ROS production

  • Regulation of mitophagy and apoptotic resistance

  • Influence on cancer stem cell properties

Methodological approaches for cancer-UCP2 research:

  • Bioinformatic analysis of UCP2 expression across cancer datasets (TCGA, GEO)

  • Construction of risk score models incorporating UCP2 expression

  • Correlation of UCP2 with tumor immune infiltration and glycolysis markers

  • Functional manipulation in cancer cell lines (knockdown/overexpression)

  • Patient-derived xenograft models with UCP2 modulation

Clinical relevance:

  • UCP2 expression serves as a prognostic marker in colon cancer patients

  • SLC25A5 (another mitochondrial carrier) downregulation in cancer correlates with poor survival

  • Negative correlation between CD8 and SLC25A5 in specimens from patients with advanced colon cancer

This research area highlights the complex roles of mitochondrial carriers in cancer progression and their potential as both biomarkers and therapeutic targets .

What are the methodological considerations for studying UCP2 interactions with other mitochondrial proteins?

Investigating UCP2's interactome represents a challenging but crucial aspect of understanding its complete biological function. Researchers should consider these methodological approaches:

Protein-protein interaction methods:

  • Co-immunoprecipitation with crosslinking: Particularly useful for capturing transient interactions

  • Proximity labeling approaches: BioID or APEX2 fused to UCP2 to identify proximal proteins

  • Split-fluorescent protein complementation: To visualize interactions in living cells

  • Blue native PAGE: For preserving intact mitochondrial complexes

  • Cryo-electron microscopy: For structural characterization of UCP2-containing complexes

Functional interaction studies:

  • Mitochondrial respiration measurements after manipulating potential interactors

  • Calcium flux measurements to assess relationships with MPTP components

  • Metabolomic analysis to identify substrate transport affected by interacting proteins

Notable interaction partners to investigate:

  • Components of the mitochondrial permeability transition pore

  • Metabolite carriers in the SLC25 family

  • Proteins involved in mitochondrial dynamics

  • Regulators of the electron transport chain complexes

Research has shown that UCP2 function may be modulated and/or linked to the assembly of cytochrome c oxidase (COX) via pathways that remain to be fully characterized . Additionally, the relationship between UCP2 and other SLC25 family members involved in metabolite transport is an area requiring further investigation, particularly regarding heme synthesis and iron homeostasis .

How do post-translational modifications regulate UCP2 function and stability?

Post-translational modifications (PTMs) represent an important but understudied aspect of UCP2 regulation:

Known and predicted UCP2 PTMs:

  • Phosphorylation at multiple serine/threonine residues

  • Glutathionylation affecting proton conductance

  • Potential ubiquitination regulating protein stability

  • Acetylation influencing activity and interactions

Methodological approaches:

  • Mass spectrometry-based proteomics: Particularly using enrichment strategies for specific modifications

  • Site-directed mutagenesis: Creating non-modifiable variants to assess functional consequences

  • Phospho-specific antibodies: For tracking modification status under various conditions

  • In vitro modification systems: Reconstituting modification reactions with purified components

Physiological contexts affecting UCP2 PTMs:

  • Metabolic stress conditions (high glucose, lipotoxicity)

  • Inflammatory signaling (via cytokines, TLR ligands)

  • Redox state fluctuations

  • Hormonal stimulation (insulin, leptin, ghrelin)

Research suggests that dynamic regulation of UCP2 through PTMs likely contributes to its ability to respond rapidly to changing cellular conditions, particularly during metabolic stress and inflammatory challenges. These modifications may represent targetable mechanisms for modulating UCP2 activity in therapeutic contexts.

What are the optimal experimental models for studying UCP2 function in metabolic disorders?

Selecting appropriate experimental models is crucial for investigating UCP2's role in metabolic diseases:

Cellular models:

  • Pancreatic β-cell lines for studying insulin secretion

  • Adipocyte models for examining lipid metabolism

  • Hepatocytes for glucose production studies

  • Skeletal muscle cells for investigating insulin sensitivity

  • Macrophages for inflammatory response assessment

Animal models:

  • Global and tissue-specific UCP2 knockout mice

  • UCP2 overexpression models

  • Diet-induced obesity models with UCP2 manipulation

  • Genetic models of diabetes with UCP2 alterations

Strengths and limitations:

Model TypeStrengthsLimitations
Cell linesMechanistic detail, high throughputLimited physiological context
Primary cellsPhysiological relevanceShort lifespan, variability
Rodent modelsWhole-body physiology, genetic manipulationSpecies differences
Human samplesDirect clinical relevanceLimited experimental manipulation

Novel approaches:

  • Organoids incorporating UCP2 genetic manipulation

  • Patient-derived cells with UCP2 polymorphisms

  • CRISPR-engineered cell lines with specific UCP2 variants

  • Humanized mouse models for studying human UCP2 variants

Genetic variations in UCP2 have been associated with obesity and type 2 diabetes, making these metabolic conditions particularly relevant for UCP2 research . The choice of model should align with the specific metabolic phenotype under investigation.

What techniques are most effective for measuring UCP2-mediated proton leak?

Accurate assessment of UCP2's primary function—proton conductance—requires specialized techniques:

Gold-standard approaches:

  • Oxygen consumption measurements:

    • High-resolution respirometry with isolated mitochondria

    • Seahorse XF analyzer for intact cells

    • Simultaneous membrane potential measurements

  • Proton leak kinetics:

    • Titration of respiratory inhibitors while measuring membrane potential

    • Calculation of proton leak rate at fixed membrane potentials

    • Comparison of native vs. UCP2-depleted mitochondria

  • Patch-clamp electrophysiology:

    • Direct measurement of proton currents

    • Assessment of substrate specificity

    • Evaluation of inhibitors and activators

Experimental considerations:

  • Control for compensatory mechanisms in chronic models

  • Use of specific activators (fatty acids) and inhibitors (GDP)

  • Normalization to mitochondrial content

  • Accounting for tissue-specific differences in UCP2 activity

Data interpretation challenges:

  • Distinguishing UCP2-specific vs. non-specific proton leak

  • Controlling for effects on electron transport chain efficiency

  • Accounting for adaptive responses to UCP2 manipulation

These methodologies allow for rigorous quantitative assessment of UCP2's uncoupling activity across different experimental conditions and genetic backgrounds.

How can researchers target UCP2 for therapeutic development?

Developing therapeutic strategies targeting UCP2 represents a promising but challenging frontier:

Potential therapeutic approaches:

  • Small molecule modulators:

    • Activators for treating metabolic disorders and inflammation

    • Inhibitors for potential cancer applications

    • Tissue-specific delivery systems

  • Gene therapy approaches:

    • Adeno-associated virus-mediated UCP2 overexpression shown to inhibit atherosclerotic plaque formation

    • Targeted delivery to endothelial cells or other relevant tissues

    • CRISPR-based modulation of UCP2 expression

  • Indirect modulation:

    • Targeting UCP2 transcriptional regulators (e.g., KLF2)

    • Modulating post-translational modifications

    • Metabolic interventions affecting UCP2 activity

Screening methodologies:

  • Fluorescence-based assays for mitochondrial membrane potential

  • High-content imaging for mitochondrial function

  • Structure-based virtual screening using UCP2 models

  • Phenotypic screening in disease-relevant cell types

Therapeutic contexts:

  • Vascular inflammation and atherosclerosis

  • Metabolic disorders (obesity, diabetes)

  • Ischemia-reperfusion injury

  • Neurodegenerative conditions

  • Cancer (context-dependent approach)

Research on endothelial UCP2 has demonstrated that its overexpression can inhibit atherosclerotic plaque formation, suggesting therapeutic potential in cardiovascular disease . Similarly, the association of UCP2 variants with obesity risk indicates potential applications in metabolic disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.