Recombinant Human Mitochondrial uncoupling protein 3 (UCP3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Mitochondrial Uncoupling Protein 3 (UCP3)

Recombinant Human UCP3 is a bioengineered variant of the mitochondrial uncoupling protein 3, produced through bacterial expression systems (typically E. coli) and purified for experimental use. Native UCP3 is encoded by the UCP3 gene (chromosome 11q13.4) and belongs to the mitochondrial anion carrier protein (MACP) family, with primary roles in mitochondrial metabolism and energy regulation . While historically proposed as a proton uncoupler, recent evidence highlights its function as a metabolite transporter, resolving long-standing debates about its physiological role .

Structure and Localization

FeatureDetail
Gene LocusChromosome 11q13.4 (7 exons)
Protein Length~282 amino acids (exact recombinant fragment: 181–214 residues)
LocalizationMitochondrial inner membrane
Expression TissuesSkeletal muscle, brown adipose tissue (BAT), heart, and macrophages

Recombinant UCP3 is typically expressed as a truncated fragment (e.g., residues 181–214) in E. coli, achieving >90% purity for biochemical assays . Native UCP3 shares structural homology with UCP2 but differs in substrate affinity and transport kinetics .

Metabolite Transport

Recent studies reconstituting recombinant UCP3 into liposomes revealed its role in exchanging anionic metabolites:

SubstrateExchange Rate (μmol/min/mg)Key Observations
Aspartate~23.9 (murine UCP3) Strict exchange with phosphate; abolished by R282Q mutation
Malate~17.5 (murine UCP3) Shared substrate preference with UCP2, but differing kinetics
Sulfate~17.5 (murine UCP3) Critical for mitochondrial ROS mitigation
PhosphateModerate exchange Bidirectional transport (unlike UCP2)

Unlike UCP2, UCP3 lacks unidirectional transport activity and exhibits higher affinity for aspartate (~7-fold) . These findings challenge the traditional view of UCP3 as a proton uncoupler and instead position it as a key regulator of TCA cycle intermediates .

Thermogenic and Proton Leak Debates

HypothesisEvidence
Proton UncouplingFatty acid-activated proton transport in planar bilayers ; abolished by GDP
No Major UncouplingUCP3 knockout mice show normal thermogenesis; fasting-induced UCP3 upregulation does not increase proton leak

Cardiometabolic Implications

  • ROS Mitigation: UCP3 deficiency exacerbates mitochondrial ROS production in cardiomyocytes, worsening diastolic dysfunction during hypertension .

  • Fatty Acid Metabolism: UCP3 transports fatty acid anions, protecting against lipid-induced oxidative stress .

  • Exercise and Obesity: High-fat diets upregulate UCP3 in skeletal muscle, but transgenic overexpression does not consistently reduce ATP synthesis .

Tissue-Specific Roles

TissueUCP3 Function
Skeletal MuscleRegulates aspartate/malate exchange; protects against fatty acid overload
HeartMitigates ROS during ischemia/reperfusion; prevents diastolic dysfunction
Brown Adipose TissueComplementary to UCP1; modulates GDP-sensitive respiration

Recombinant UCP3 Production and Utility

AttributeDetail
Expression SystemE. coli; recombinant fragment (181–214 residues)
Purity>90% (SDS-PAGE verified)
ApplicationsLiposome reconstitution, ELISA, Western blotting, substrate transport assays

Recombinant UCP3 is critical for isolating its transport activity from confounding factors in vivo. For example, R282Q mutants (transport-deficient) confirm substrate specificity .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, customers may request a specific tag type, which we will prioritize if possible.
Synonyms
UCP3; SLC25A9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
UCP3
Target Protein Sequence
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA LMKVQMLRESPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, uncoupling oxidative phosphorylation. This process dissipates energy as heat. UCP3 may modulate tissue respiratory control and is involved in thermogenesis and energy balance.
Gene References Into Functions

References Supporting UCP3 Function and Association with Disease:

  1. Polymorphisms rs3813929 and rs1800849 in the 5-HT2C and UCP3 genes were associated with type 2 diabetes mellitus prevalence in obese Brazilian women undergoing bariatric surgery. PMID: 28977211
  2. In type 2 diabetics, the UCP3-55 CC genotype combined with the PPARgamma2 Pro12Ala genotype correlated with significantly higher BMI, partly due to reduced lipid oxidation. PMID: 27089973
  3. In a Spanish population, responses to a high-protein/low-carbohydrate diet varied based on the UCP3 -55CT polymorphism (rs1800849). PMID: 26848765
  4. UCP-3 demonstrated functional significance for hypoxic/reoxygenation resistance. PMID: 26304588
  5. UCP3 overexpression limited keratinocyte proliferation and tumorigenesis by inhibiting Akt. PMID: 26310111
  6. Children with the UCP-3 -55 T/T genotype had significantly lower adjusted metabolic rates than those with the C allele. PMID: 25081806
  7. A novel functional variant (rs1626521) in UCP-3 affected postprandial gastric function, satiety, weight gain, and mitochondrial function. PMID: 25755013
  8. The UCP3 genotype was more prevalent in women who survived the Siege of Leningrad compared to age-matched controls. PMID: 25826986
  9. Analysis of SNPs in/near UCP3 and RPTOR genes and their effects on obesity-related traits. PMID: 25533680
  10. Two independent populations showed an association between the UCP3 -55CT polymorphism and lower BMI. PMID: 24026107
  11. In individuals with the UCP3 -55CC genotype, a high monounsaturated hypocaloric diet reduced various metabolic risk factors. PMID: 24174365
  12. A higher prevalence of the UCP3 rs11235972 GG genotype was found in Chinese children with nonalcoholic fatty liver disease. PMID: 24124336
  13. The T allele of the UCP3 gene was associated with higher VO2 max and might be considered an endurance-related allele. PMID: 23505621
  14. Carriers of the UCP3 -55CT polymorphism T allele showed no metabolic response to weight loss induced by a hypocaloric diet rich in polyunsaturated fatty acids. PMID: 23165529
  15. Meta-analysis showed no association between the UCP3 -55C/T polymorphism and obesity. PMID: 23560041
  16. UCP3 polymorphisms were not associated with HIV-associated sensory neuropathy in African individuals. PMID: 23521650
  17. The UCP2 Ala55Val polymorphism was associated with increased susceptibility to type 2 diabetes mellitus in Asians. PMID: 23365654
  18. Similar prevalence of mutant UCP genotypes were observed in patients with and without metabolic syndrome. PMID: 22811361
  19. In obese subjects with type 2 diabetes, the UCP3 -55CC→CT polymorphism was associated with fat distribution, adiposity, and cardiovascular risk factors. PMID: 21897112
  20. Interaction between the UCP3 -55CT polymorphism and the beta3-adrenoreceptor Trp64Arg polymorphism on insulin resistance in obese patients was reported. PMID: 22774401
  21. Telmisartan improved UCP3 activity, including dominant-negative mutants. PMID: 21544083
  22. Meta-analysis indicated that the UCP3 -55C/T polymorphism may be a risk factor for type 2 diabetes in Asians but not Europeans. PMID: 21751002
  23. The sensitivity of SERCA to mitochondrial ATP production suggests that mitochondria control local ATP availability at ER Ca(2+) uptake and release sites. PMID: 21775425
  24. More efficient uncoupling had a beneficial effect on aging muscle. PMID: 21336965
  25. The UCP3 -55C/T genotype showed a protective effect against diabetes development. PMID: 21175267
  26. Climate adaptation influenced the global distribution of UCP1 and UCP3 allele frequencies, suggesting a role in cold resistance for UCP3. PMID: 20802238
  27. Distinct sites in the IML2 of UCP3 affected mitochondrial uptake of high and low Ca(2+) signals. PMID: 21047682
  28. The -55CT genotype was associated with higher insulin resistance, lower adiponectin levels, and more severe steatosis and inflammation than the -55CC genotype. PMID: 20694293
  29. The UCP3 -55 C/T polymorphism did not affect weight loss or clinical outcomes after bariatric surgery. PMID: 18484143
  30. Cardiorespiratory fitness modified the association between the rs1800849 polymorphism and homocysteine. PMID: 20031128
  31. Patients with the -55CC UCP3 genotype had higher weight, fat mass, and insulin resistance than those with the wild-type genotype. PMID: 19913848
  32. The UCP3 gene was associated with body composition changes with training. PMID: 11842047
  33. UCP3 mRNA levels were elevated in weight loss associated with gastrointestinal adenocarcinoma. PMID: 11875702
  34. Fasting activated UCP3 gene expression independently of lipid transport and oxidation genes, suggesting a role in fatty acid homeostasis regulation during fasting. PMID: 12051710
  35. UCP3 protein content was related to energy metabolism and cold adaptation. PMID: 12075570
  36. Depressed UCP3 expression may reduce the formation of oxygen-derived free radicals. PMID: 12145475
  37. Metabolic and anthropometric factors related to skeletal muscle UCP3 gene expression in healthy adults. PMID: 12217879
  38. UCP3 mRNA expression depended on human muscle differentiation. PMID: 12351640
  39. UCP3 played a role in postnatal activation of lipid oxidation and mitochondrial energy conversion in preterm neonates. PMID: 12612210
  40. Training status affected UCP3 content more in type I and type IIa than in type IIx muscle fibers. PMID: 12634927
  41. Purine nucleotides may be physiological inhibitors of UCP3-mediated uncoupling. PMID: 12670931
  42. Study of recombinant UCP3 isolation, refolding, transport properties, and regulation. PMID: 12734183
  43. UCP3 polymorphisms were associated with waist-to-hip ratio. PMID: 12756473
  44. Skeletal muscle UCP3 mRNA expression was downregulated after lowering plasma free fatty acid concentrations, despite increased energy expenditure. PMID: 12824081
  45. Convergence of MyoD and PPAR-dependent pathways provided a molecular mechanism for skeletal muscle specificity and fatty acid regulation of the human UCP3 gene. PMID: 12843208
  46. Up-regulation of UCP3 in riboflavin-responsive multiple acylcoenzyme A dehydrogenase deficiency was due to muscle fatty acid/acylCoA accumulation. PMID: 14671191
  47. UCP3 played a role in fuel substrate management and energy metabolism, influencing body weight regulation. PMID: 15045692
  48. Association between BMI and the UCP3 -55 C→T polymorphism in diabetic nephropathy. PMID: 15120704
  49. IGF-1 may protect against hyperglycemia-induced oxidative stress and neuronal injuries by regulating mitochondrial membrane potential, possibly involving UCP3. PMID: 15211595
  50. No association was found between the UCP3 -55 C/T polymorphism and ultra-endurance performance in triathletes. PMID: 15346230
Database Links

HGNC: 12519

OMIM: 601665

KEGG: hsa:7352

STRING: 9606.ENSP00000323740

UniGene: Hs.101337

Involvement In Disease
Obesity (OBESITY)
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles.

Q&A

What is UCP3 and what are its primary functions?

UCP3 (Uncoupling Protein 3) belongs to the mitochondrial anion carrier proteins (MACP) family. Initially, UCP3 was thought to function as a proton transmembrane transporter from the mitochondrial intermembrane space into the matrix, causing proton leaks through the inner mitochondrial membrane. This would uncouple oxidative phosphorylation from ATP synthesis, dissipating energy as heat .

  • Protection of mitochondria against lipid-induced oxidative stress

  • Facilitation of fatty acid export from mitochondria when fatty acid supply exceeds oxidation capacity

  • Metabolite transport that may indirectly affect mitochondrial coupling

Methodologically, when studying UCP3 function, researchers should:

  • Compare results across multiple experimental systems (isolated mitochondria, reconstituted proteins, cellular models)

  • Control for metabolic conditions that affect UCP3 expression

  • Consider that UCP3's function may be context-dependent rather than constitutive

How is UCP3 expressed in different tissues and how can this expression be reliably measured?

UCP3 shows a tissue-specific expression pattern, being primarily expressed in skeletal muscle . Expression levels increase when fatty acid supplies to mitochondria exceed their oxidation capacity . This tissue specificity is a critical consideration when designing experiments.

For reliable measurement of UCP3 expression, researchers should consider:

mRNA quantification:

  • Real-time PCR with validated primers

  • RNA-seq for genome-wide expression analysis

Protein detection:

  • Western blotting with validated antibodies

  • Immunohistochemistry for tissue localization

Important methodological considerations:

  • UCP3 has an unusually short half-life of approximately 30 minutes (compared to 30 hours for UCP1 and 12 days for most mitochondrial inner-membrane proteins)

  • RNA expression may not correlate with protein levels due to rapid protein degradation by the cytosolic proteasome

  • Timing of sample collection should be standardized and reported

What are the structural characteristics of human UCP3?

Human UCP3 exists in two isoforms: a long isoform (UCP3L) and a short isoform (UCP3S) . The protein shares significant homology with other UCPs, particularly UCP1, which complicates specific antibody development and functional characterization.

Key structural features include:

  • Six transmembrane domains organized into three repeats, similar to other mitochondrial carriers

  • Specific arginine residues (R183 and R84) crucial for interaction with purine nucleotides

  • R184 interacts with the α-phosphate of purine nucleotides, while R84 interacts with the β-phosphate

When studying UCP3 structure, researchers should:

  • Consider the high homology between UCPs when interpreting structural data

  • Use proper controls to ensure specificity when targeting UCP3

  • Carefully design site-directed mutagenesis experiments to distinguish UCP3 from other UCPs

How do I select appropriate antibodies for UCP3 detection?

Antibody selection for UCP3 is particularly challenging due to high homology with other mitochondrial carriers. The following methodological approach is recommended:

  • Antibody selection criteria:

    • Target peptides with lowest homology to other proteins

    • Avoid hydrophobic regions likely to be in membrane domains

    • Use affinity-purified antibodies when possible

  • Essential validation steps:

    • Positive control: Recombinant full-length UCP3 protein

    • Negative controls: UCP3 knockout tissue/cells or knockdown models

    • Western blot showing expected molecular weight (33-36 kDa range)

  • Testing parameters:

    • Optimal antibody dilutions (WB: 1/500-2000, IHC: 1/20-1/200, IF: 1/50-1/200)

    • Buffer optimization to reduce non-specific binding

    • Validation across multiple detection methods

Remember that polyclonal antibodies are most commonly used for UCP3 detection, but their specificity must be rigorously validated .

How can UCP3 transport function be reliably measured in experimental systems?

Measuring UCP3 transport function has produced contradictory results across different experimental systems. The following methodological approaches can provide reliable functional data:

In isolated mitochondria:

  • Oxygen consumption rates in the presence/absence of UCP3 inhibitors

  • Membrane potential measurements using fluorescent probes

  • In vivo assessment of phosphocreatine resynthesis following anoxic muscle contractions

In reconstituted systems:

  • Liposomes containing purified UCP3 for direct proton transport measurements

  • Planar bilayer membranes for electrophysiological recordings

  • Careful control of lipid composition and protein orientation

Critical parameters and controls:

  • Include positive controls (UCP1) and negative controls (mutants)

  • Test both activators (fatty acids) and inhibitors (purine nucleotides)

  • Measure proton transport rates under standardized conditions

  • Compare results across different experimental systems

  • Control for protein amount and orientation in reconstituted systems

The measured proton transport rate of reconstituted recombinant UCP3 (2.6/s) is approximately 5-fold lower than UCP1 (13.5/s), which is important when interpreting functional data .

What is the current understanding of the mechanism of purine nucleotide inhibition of UCP3?

Recent research has clarified the mechanism of UCP3 inhibition by purine nucleotides, revealing important differences from UCP1:

Key findings on UCP3 inhibition mechanism:

FeatureUCP1UCP3
Essential arginine for inhibitionR277R183
α-phosphate bindingR277R183
β-phosphate bindingR183R84
γ-phosphate bindingR84Unknown residue
Effect of phosphorylation levelAdditive effectIC50 decreases with increased phosphorylation
R277/R278 roleEssentialNot part of binding pocket

Methodological approaches to study inhibition:

  • Site-directed mutagenesis of specific arginine residues

  • Direct measurement of nucleotide binding using fluorescence or other binding assays

  • Functional transport assays in the presence of different nucleotides

  • Structural analysis using circular dichroism (CD) to detect conformational changes

Experiments with mutated arginines suggest that the interaction between R183 and α-phosphate of the nucleotide is essential for UCP3 inhibition and, by itself, causes full inhibition. The IC50 of inhibition is further decreased by bond formation between arginines and the β- and γ-phosphates .

How can researchers resolve contradictory data regarding UCP3's uncoupling function?

The literature contains contradictory findings regarding UCP3's uncoupling function. A systematic approach can help resolve these discrepancies:

Methodological considerations:

  • In vivo vs. in vitro studies:

    • Human studies by Hesselink et al. found that a 44% increase in UCP3 protein in skeletal muscle (induced by high-fat diet) did not affect mitochondrial proton leak in vivo, as measured by phosphocreatine resynthesis

    • This contrasts with findings in isolated mitochondria and reconstituted systems

  • Expression level considerations:

    • Supraphysiological expression in recombinant systems may yield results not representative of normal function

    • Physiological upregulation may be insufficient to observe uncoupling effects

  • Experimental context:

    • Substrate availability must be controlled (particularly fatty acids)

    • Metabolic state of the tissue/cells affects UCP3 function

    • Different measurement techniques may capture different aspects of function

Research approach to resolve contradictions:

  • Combine complementary techniques in the same experimental model

  • Perform side-by-side comparisons with UCP1 as a positive control

  • Test function across a range of expression levels

  • Consider post-translational modifications and protein-protein interactions

  • Design experiments that can differentiate between primary functions and secondary effects

What are the best methods for reconstituting UCP3 in biomimetic systems?

Reconstituting UCP3 in biomimetic systems offers advantages for functional studies but requires careful methodological considerations:

Protein preparation:

  • Expression systems:

    • Bacterial systems (E. coli) for high yield but may require refolding

    • Yeast or insect cell systems for improved folding

    • Cell-free systems to avoid aggregation

  • Purification strategies:

    • Gentle detergent solubilization to maintain native structure

    • Affinity chromatography with appropriate tags

    • Size exclusion chromatography for homogeneity

Reconstitution systems:

  • Liposomes:

    • Defined lipid composition (consider cardiolipin content)

    • Control of protein orientation

    • Suitable for transport assays

  • Planar bilayer membranes:

    • Allows electrical measurements

    • Direct observation of single-protein activity

    • Enables precise control of conditions on both sides

  • Nanodiscs:

    • Native-like lipid environment

    • Suitable for structural studies

    • Maintains protein stability

Critical quality controls:

  • Verification of protein incorporation and orientation

  • Functional validation using known activators and inhibitors

  • Comparison of properties with native protein when possible

In biomimetic systems, reconstituted UCP3 has demonstrated proton transport activity with a rate of 2.6 protons per second, which is fivefold lower than UCP1 (13.5/s) . This quantitative difference is important when designing experiments and interpreting results.

How can we study UCP3 regulation at the transcriptional and post-translational levels?

UCP3 expression and activity are regulated at multiple levels, requiring diverse methodological approaches:

Transcriptional regulation:

  • Promoter analysis:

    • Reporter gene assays

    • ChIP-seq for transcription factor binding

    • DNA footprinting

    • Investigation of response elements for fatty acids, thyroid hormone, and other regulators

  • mRNA analysis:

    • Stability assays (actinomycin D chase)

    • Splicing studies (for long and short isoforms)

    • Polysome profiling for translational efficiency

Post-translational regulation:

  • Protein stability studies:

    • Pulse-chase experiments to measure half-life

    • Proteasome inhibitor studies (UCP3 is degraded via the cytosolic proteasome)

    • Ubiquitination analysis

  • Modification analysis:

    • Phosphorylation site mapping

    • Acetylation studies

    • Redox modifications

  • Protein-protein interactions:

    • Co-immunoprecipitation

    • Proximity labeling approaches

    • Yeast two-hybrid screens

The unusually short half-life of UCP3 (approximately 30 minutes) compared to UCP1 (30 hours) and most mitochondrial proteins (12 days) suggests that post-translational regulation is particularly important for UCP3 . Researchers must account for this rapid turnover when designing experiments.

What advanced techniques are available for structural analysis of UCP3?

Structural characterization of membrane proteins like UCP3 presents significant challenges. Advanced techniques include:

Spectroscopic methods:

  • Circular dichroism (CD) for secondary structure analysis and monitoring conformational changes upon nucleotide binding

  • FTIR spectroscopy for structural characterization in different lipid environments

  • Nuclear magnetic resonance (NMR) for dynamic structural information

Microscopy approaches:

  • Atomic force microscopy (AFM) for topographical analysis and binding site depth measurement

  • Cryo-electron microscopy for high-resolution structural data

  • Single-molecule FRET for conformational dynamics

Modeling and computational methods:

  • Homology modeling based on related proteins with known structures

  • Molecular dynamics simulations to study transport mechanisms

  • Structure-function predictions to guide mutagenesis studies

When studying UCP3 structure, researchers should consider that:

  • The nucleotide binding site has been estimated to be 1.27 nm from the membrane surface

  • Nucleotides can bind from both the intermembrane and matrix sides

  • Only binding from the intermembrane side leads to inhibition

What are the most appropriate experimental models for studying UCP3 function?

Different experimental models offer complementary insights into UCP3 function:

In vitro systems:

  • Reconstituted protein in liposomes or planar membranes

  • Advantages: Direct measurement of transport properties

  • Limitations: Lack of cellular regulatory factors

Cellular models:

  • Skeletal muscle cell lines with endogenous UCP3

  • Overexpression systems for mechanistic studies

  • Knockdown/knockout cell lines as controls

  • Advantages: Physiological regulation present

  • Limitations: Background activities from other transporters

Animal models:

  • UCP3 knockout mice

  • Transgenic overexpression models

  • Diet-induced models (high-fat feeding increases UCP3 expression)

  • Advantages: System-level physiological relevance

  • Limitations: Species differences in UCP3 function

Human studies:

  • Muscle biopsies for ex vivo analysis

  • Metabolism studies using phosphocreatine resynthesis

  • Genetic association studies

  • Advantages: Direct relevance to human physiology

  • Limitations: Experimental constraints and ethical considerations

The selection of experimental models should be guided by the specific research question, with consideration of the strengths and limitations of each approach.

How is UCP3 involved in human metabolism and pathophysiological states?

UCP3 has been implicated in various metabolic and pathophysiological conditions:

Metabolic roles:

  • Fatty acid metabolism and export from mitochondria when supply exceeds oxidation capacity

  • Protection against lipid-induced oxidative stress

  • Potential involvement in energy expenditure (though evidence is conflicting)

Pathophysiological associations:

  • Genetic polymorphisms associated with Body Mass Index Quantitative Trait Locus 11

  • Potential role in obesity and diabetes development

  • Possible involvement in leptin function (associated with Leptin Deficiency Or Dysfunction)

Research approaches to study pathophysiological roles:

  • Analysis of UCP3 expression in muscle biopsies from patients with metabolic disorders

  • Correlation of UCP3 variants with clinical phenotypes

  • Functional characterization of UCP3 variants in cellular and reconstituted systems

  • Metabolic chamber studies in animal models with altered UCP3 expression

When studying UCP3 in disease contexts, researchers should consider that alterations in UCP3 function may be either causative or compensatory, requiring careful experimental design to distinguish these possibilities.

How does UCP3 interact with other mitochondrial proteins and pathways?

Understanding UCP3's interactions with other mitochondrial components is essential for interpreting its physiological role:

Pathway interactions:

  • Respiratory electron transport chain

  • ATP synthesis by chemiosmotic coupling

  • Heat production by uncoupling proteins

  • Fatty acid metabolism and cycling

Protein interactions:

  • Potential interactions with other mitochondrial carriers

  • Regulatory proteins that may modulate UCP3 function

  • Components of the protein quality control machinery (given its rapid turnover)

Methodological approaches:

  • Co-immunoprecipitation with appropriate controls

  • Proximity labeling techniques (BioID, APEX)

  • Functional assays in the presence of specific pathway inhibitors

  • Metabolic flux analysis to identify affected pathways

When studying these interactions, researchers should account for the potential influence of experimental conditions on protein associations and pathway activities.

What are the most pressing unanswered questions about UCP3 function?

Despite extensive research, several fundamental questions about UCP3 remain unresolved:

  • Primary physiological function:

    • Is uncoupling a primary function or secondary effect?

    • What is the predominant role in different tissues and metabolic states?

  • Regulation mechanisms:

    • How is UCP3's rapid turnover regulated?

    • What factors control its activation and inhibition in vivo?

  • Structural characteristics:

    • What is the complete three-dimensional structure?

    • How does structure relate to transport specificity?

  • Pathophysiological relevance:

    • What is UCP3's role in metabolic diseases?

    • Could UCP3 be a therapeutic target?

Methodological approaches to address these questions:

  • Integration of multiple experimental systems

  • Development of more specific modulators of UCP3 function

  • Application of advanced structural biology techniques

  • Longitudinal studies in appropriate disease models

As research techniques continue to advance, these questions may become more tractable, leading to a clearer understanding of UCP3's role in human physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.