Recombinant Human Mitofusin-1 (MFN1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Mitofusin-1 (MFN1)

Recombinant Human Mitofusin-1 (MFN1) is a protein crucial for mitochondrial fusion, a process essential for maintaining healthy cells and tissues . MFN1, a dynamin-related GTPase, resides in the outer mitochondrial membrane and mediates the fusion of mitochondria with the help of Mitofusin 2 (MFN2) . These mitofusins are homologous to Drosophila's Fzo protein and yeast's yFzo1p, which are the only known mediators of mitochondrial fusion in their respective species .

Structure and Function of MFN1

Human MFN1 is a 741 amino acid protein with two transmembrane domains and cytoplasmic N- and C-termini . Key domains of MFN1 include a coiled-coil region for MFN1/MFN2 binding and a GTPase domain, which cleaves GTP to facilitate membrane fusion . MFN1 interacts with MFN1 and MFN2 on adjacent mitochondria to mediate mitochondrial fusion . This fusion process is vital for maintaining mitochondrial membrane potential and apoptosis .

MFN1 in Mitochondrial Dynamics

Mitochondria are dynamic organelles that undergo continuous fusion and fission, processes vital for their function in ATP production, calcium regulation, and apoptosis . MFN1 plays a critical role in mitochondrial fusion, influencing mitochondrial morphology and function . Overexpression of MFN1 leads to the formation of interconnected mitochondrial networks, while disruption of MFN1 function results in mitochondrial fragmentation .

MFN1 and Disease Implications

MFN1 is implicated in various diseases, including neurodegenerative disorders, cardiovascular diseases, and metabolic syndromes .

  • Cardiac Failure: Studies have shown that MFN1 expression is decreased in heart failure patients who do not respond to established treatments . Cardiac-specific deletion of MFN1 in mice results in reduced systolic function and increased mitochondrial alteration .

  • Cancer: MFN1 is involved in cancer cell apoptosis and inflammation . It interacts with proteins like Bak to promote mitochondrial permeabilization and cell death .

  • Charcot-Marie-Tooth Disease Type 2A: Research indicates the importance of mitofusin activation in treating this condition .

MFN1 and Macrophage Function

MFN1-mediated mitochondrial fusion regulates macrophage function during infection .

  • Mtb Infection: MFN1 mediates mitochondrial fusion in macrophages infected with Mycobacterium tuberculosis (Mtb), increasing ATP production and enhancing mycobactericidal activity . Silencing MFN1 inhibits mitochondrial fusion, reduces ATP production, and impairs macrophage function .

  • OXPHOS and ATP Production: MFN1 regulates macrophage mycobactericidal activity by influencing oxidative phosphorylation (OXPHOS) and ATP production .

MFN1 Modulation and Therapeutic Potential

Modulating MFN1 activity presents a promising strategy for treating mitochondrial-related diseases . MFN1 serves as a potential therapeutic target, and further research into its molecular mechanisms may unlock new avenues for clinical interventions .

MFN1 Regulation

  • ERK Phosphorylation: Extracellular Regulated Kinase (ERK) phosphorylates MFN1, modulating its role in apoptosis and mitochondrial fusion .

  • miRNAs: MicroRNAs, such as miR-140-5p, can negatively regulate MFN1 expression, impacting mitochondrial function in diseases like cardiac failure .

MFN1 and Cellular Processes

  • Apoptosis: MFN1 influences apoptosis by interacting with proteins like Bak, leading to mitochondrial outer membrane permeabilization and cytochrome c release .

  • Calcium Signaling: MFN1, along with MFN2, acts as a bridge between mitochondria and the endoplasmic reticulum, influencing calcium uptake and signaling .

Research Findings

StudyFindings
Hsiao et al., 2021MFN1 expression and mitochondrial size are significantly decreased in cardiomyocytes of heart failure patients; miR-140-5p negatively regulates MFN1 expression .
Zhou et al., 2015MnTBAP stimulates angiogenesis in endothelial cells via the P13K/Akt/eNOS pathway, dependent on MFN1 .
Reyes, 2020Nitrite upregulates MFN1, causing cell cycle arrest and preventing growth factor-activated proliferation of rat aortic smooth muscle cells; oral nitrite attenuates neointimal hyperplasia in MFN1 knock-out mice .
Park et al., 2010A mutant of MFN1 with deficient GTPase (T109A) interrupts mitochondrial elongation and diminishes cellular senescence .
Liu et al., 2020aSelenium-based nanoparticles target tumor cell mitochondria using TLR4, TRAF3, and MFN1 pathway to induce cancer cell apoptosis .
Yu et al., 2022Protodioscin increases MFN1 and Bak levels, disrupting mitochondrial membrane potential and inducing apoptosis in HCC cells; Bak and MFN1 form a complex with IP3R to promote calcium shifting from the ER to mitochondria and cell death .
Chen et al., 2018a, Chen et al., 2018bMFN1 level is significantly higher in the posterior part of the prostate gland in rat BPH, enhancing mitochondrial fusion and inhibiting apoptosis; miR5338 decreases MFN1 levels, inhibits fusion, enhances apoptosis, and improves BPH .
Santel, Frank, Gaume, Herrler, Youle, Fuller, 2003Mfn1 protein is a generally expressed mediator of mitochondrial fusion in mammalian cells; overexpression of Mfn1 in cultured cells causes formation of characteristic networks of mitochondria; a point mutation in the conserved G1 region of the predicted GTPase domain(Mfn1 K88T) dramatically decreased formation of mitochondrial networks upon Mfn1 overexpression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MFN1; Mitofusin-1; Fzo homolog; Transmembrane GTPase MFN1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-741
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGY KDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDG DKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSP GTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWD ASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMP ESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNL AAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL SVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGRNLADRCTDEVNALVLQTQQEIIENL KPLLPAGIQDKLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFPFSLGWSSLVHRFLGPRN AQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGLASVTSRTSMGII IVGGVIWKTIGWKLLSVSLTMYGALYLYERLSWTTHAKERAFKQQFVNYATEKLRMIVSS TSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAV QLENELENFTKQFLPSSNEES
Uniprot No.

Target Background

Function
Mitofusin-1 (MFN1) is a mitochondrial outer membrane GTPase that facilitates mitochondrial clustering and fusion. GTPase activity is crucial for membrane clustering, potentially involving significant rearrangement of coiled-coil domains. Mitochondrial morphology reflects the dynamic equilibrium between fusion and fission events. MFN1 overexpression induces mitochondrial network formation in vitro. It exhibits low GTPase activity.
Gene References Into Functions
  1. This research refines our understanding of MFN1 as a single-spanning outer membrane protein with an N-out/C-in orientation, providing functional insights into the intermembrane space's role in redox-regulated fusion. PMID: 29212658
  2. Findings suggest that TP53BP1 and MFN1 frameshift mutations and their intratumoral heterogeneity (ITH) may contribute to cancer development by inhibiting tumor suppressor gene (TSG) activities. PMID: 30082159
  3. This study demonstrates a metabolic shift from glycolysis in young to mitochondrial respiration in old normal human fibroblasts during chronological aging, with MFN1 and OPA1 regulating this process. PMID: 28758339
  4. Mitochondrial elongation under hypoxia is regulated via SIRT1-mediated MFN1 deacetylation and accumulation. PMID: 28669827
  5. MGRN1 and proteasome-mediated regulation of Mfn1 modulates mitochondrial fusion. PMID: 27713096
  6. SLC25A46 is identified as a novel regulator of MFN1/2 oligomerization in mitochondrial dynamics. PMID: 28057766
  7. MFN1 positive expression is observed primarily in ganglion cells after one week of minus lens intervention, increasing over time in rod-cone and bipolar cell layers; this is not seen in normal control eyes. PMID: 27609161
  8. Crystal structures of engineered human MFN1, encompassing the GTPase and helical domains during various GTP hydrolysis stages, are presented. A mechanistic model for MFN1-mediated mitochondrial tethering is proposed, illuminating the molecular basis of mitochondrial fusion and mitofusin-related neuromuscular disorders. PMID: 28114303
  9. These findings suggest that MFN tethers opposing membranes, likely through nucleotide-dependent dimerization. PMID: 27920125
  10. Dysregulation of mitofusin-1 and dynamin-related protein 1 transcription during early in vitro embryo development is linked to decreased mitochondrial membrane potential and embryo fragmentation. PMID: 25033890
  11. miR-19b targets Mfn1 3'UTR sequences, inhibiting Mfn1 expression. PMID: 24824927
  12. In an amyotrophic lateral sclerosis transgenic mouse model, Mfn1 is significantly upregulated in the spinal cord. PMID: 23713734
  13. A novel role for the endoplasmic reticulum-associated Gp78 ubiquitin ligase and the MFN1 mitochondrial fusion factor in mitophagy is described. PMID: 23427266
  14. Mitofusin protein Mfn1 knockout increases mitochondrial fission frequency and the lifespan of unpaired events, while deleting both Mfn1 and Mfn2 results in unstable dynamics. PMID: 22649485
  15. These results suggest a GTPase-dependent role for Mfn1 in regulating Bax activation on the outer mitochondrial membrane. PMID: 22484496
  16. Mitochondrial dynamics, particularly those mediated by mitofusins, influence endothelial cell function and viability. PMID: 21839087
  17. Patterned Purkinje cell degeneration depends on caspase activation, resulting in a significant decrease of mitofusin 1 in the transgenic Harlequin cerebellum. PMID: 20974255
  18. Data support a model where parkin translocation to damaged mitochondria induces mitofusin 1 degradation, impairing mitochondrial fusion. PMID: 21615408
  19. The impact of endogenous PINK1 and Parkin mutations on the ubiquitination of mitochondrial fusion and fission factors and mitochondrial network structure was investigated. PMID: 21408142
  20. Gβ2 regulates Mfn1 mobility on the mitochondrial membrane surface and affects mitochondrial fusion. PMID: 20981029
  21. Ubiquitination of several mitochondrial proteins, including mitofusin 1 and 2, is reduced following parkin or PINK1 silencing. PMID: 20871098
  22. Mitochondria-associated Parkin-mediated mitofusin degradation inhibits fusion of damaged mitochondria with healthy ones, facilitating selective elimination via autophagy. PMID: 21173115
  23. MFN1 is necessary for virus-induced IPS-1 redistribution and interferon production. PMID: 20661427
  24. The NIC-Akt-Mfn signaling cascade represents a pathway regulating cell survival independently of canonical NIC functions. PMID: 20339081
  25. Mitofusin 1 and 2, Fzo homologs, are ubiquitous mitochondrial membrane proteins that interact to facilitate mitochondrial targeting. PMID: 11950885
  26. MFN1 mediates mitochondrial fusion in human cells. PMID: 12475957
  27. OPA1 functionally requires mitofusin 1 for mitochondrial fusion regulation. PMID: 15509649
  28. Mfn1, Mfn2, NRF-2, and COX IV mRNA levels increase 24 hours post-exercise in skeletal muscle. PMID: 15961417
  29. Precise interactions between several proteins are required for mitochondrial fusion and division, with Drp1, Mfn1, Mfn2, and OPA1 being most significant. PMID: 17718388
  30. Fis1 and Mfn1 activities influence mitochondrial signaling and thus insulin exocytosis. PMID: 18832378
  31. IL-6 induces Bcl-2 expression for cytoprotection against oxygen toxicity, mediated by altering interactions between Bak and Mfn1/Mfn2; Bcl-2 inhibits the Bak-Mfn1 interaction. PMID: 19168699
Database Links

HGNC: 18262

OMIM: 608506

KEGG: hsa:55669

STRING: 9606.ENSP00000263969

UniGene: Hs.478383

Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.; [Isoform 2]: Cytoplasm.
Tissue Specificity
Detected in kidney and heart (at protein level). Ubiquitous. Expressed at slightly higher level in kidney and heart. Isoform 2 may be overexpressed in some tumors, such as lung cancers.

Q&A

What is the basic structure and localization of MFN1?

MFN1 is a GTPase protein located on the outer mitochondrial membrane. Its structure features two transmembrane regions that pass through the outer mitochondrial membrane twice, with both N-terminal G domain and C-terminal coiled-coil domains facing the cytoplasm. These domains interact with MFN family proteins or other proteins present on the exterior of neighboring mitochondria . The protein contains a GTPase domain that is essential for its function, similar to its homologs in other species such as yeast Fzo1p and Drosophila Fzo .

What is the primary function of MFN1 in mitochondrial dynamics?

MFN1 is a mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion . Its primary role involves linking nearby mitochondria and initiating the fusion of outer mitochondrial membranes without affecting the inner mitochondrial membrane . This fusion process is critical for maintaining mitochondrial network morphology, which is determined by the equilibrium between fusion and fission events . Overexpression of MFN1 in cultured cells induces the formation of perinuclear grape-like arrays of mitochondria with large mitochondria present around the outward edge .

How does the GTPase activity of MFN1 contribute to its function?

The GTPase activity of MFN1 is essential for membrane clustering and the initiation of mitochondrial fusion . Studies have shown that mutation at the K88 residue to T in the G1 G domain of MFN1 significantly diminishes its activity . The GTPase function likely enables a major rearrangement of the coiled-coil domains necessary for bringing mitochondrial membranes into close proximity . Interestingly, MFN1 has relatively low intrinsic GTPase activity, suggesting that its function may be regulated through protein interactions or post-translational modifications .

Advanced Research Applications of MFN1

MFN1 has significant roles in neurological systems, particularly in maintaining mitochondrial dynamics crucial for neuronal function:

In POMC neurons located in the hypothalamic arcuate nucleus, MFN1 loss causes elevated reactive oxygen species generation, altered mitochondrial respiration, and changes in neuronal activity . This disruption weakens glucose metabolism and reveals an association between insulin release and POMC neurons via the sympathetic nervous system .

MFN1 phosphorylation at serine 86 by βIIPKC during subarachnoid hemorrhage impairs fusion and contributes to neuronal damage . In atrophied gastrocnemius, miR-142a-5p decreases MFN1 expression, causing mitochondrial fragmentation, depolarization, and inhibition of oxidative phosphorylation .

In Charcot-Marie-Tooth type 2A (CMT2A), an inherited peripheral axonal neurological disorder, abnormal MFN1/MFN2 ratios cause retinal degeneration through P62/LC3B-regulated autophagy/mitophagy . Transgenic expression of MFN1 in this context improves vision and retinal morphology by restoring the ratio between MFN1/MFN2 and promoting PINK1-dependent, Parkin-independent mitochondrial autophagy .

How does MFN1 contribute to cardiovascular pathophysiology?

MFN1 plays critical roles in cardiovascular health and disease:

In heart failure patients classified as "non-responders" (those who show no response to established treatment), MFN1 expression and mitochondrial size in cardiomyocytes are significantly decreased . Studies using cardiac-specific MFN1-deleted mice revealed reduced systolic function and increased mitochondrial alterations .

The βAR-cAMP-PKA-miR-140-5p signaling pathway negatively regulates MFN1 expression, resulting in significant reduction in tubular respiration of neonatal rat ventricular myocytes . Elevated miR-140-5p levels are observed in non-responders, suggesting MFN1 could serve as a biomarker for cardiac failure .

In endothelial cells, MnTBAP (manganese-III-tetrakis (4-benzoic acid) porphyrin) exhibits significant angiogenic effects by stimulating the P13K/Akt/eNOS pathway, which is dependent on MFN1 . Additionally, nitrite prevents growth factor-activated proliferation of rat aortic smooth muscle cells by upregulating MFN1 and inducing cell cycle arrest, which has implications for treating neointimal hyperplasia .

What antibody considerations are important when studying MFN1 in experimental models?

When selecting antibodies for MFN1 research, several critical factors should be considered:

Monoclonal antibodies, such as the Mouse Monoclonal Mitofusin 1 antibody [3C9] (ab57602), have demonstrated reliability across multiple applications including Western Blotting (WB), Immunocytochemistry/Immunofluorescence (ICC/IF), Immunoprecipitation (IP), Flow Cytometry, and Immunohistochemistry (IHC-P) . The validated reactivity profile should match your experimental model organism, with documented reactivity for human, rat, mouse, and cynomolgus monkey samples .

For immunogen considerations, antibodies raised against recombinant full-length protein corresponding to Human MFN1 provide comprehensive epitope coverage . When studying both MFN1 and MFN2, potential cross-reactivity should be evaluated, especially since some antibodies may recognize both proteins due to structural similarities .

Application validation is critical - prioritize antibodies that have been specifically validated for your intended application and species combination, as documented by manufacturer guarantees and citation records . For instance, antibodies with extensive citation histories (such as those cited in 200+ publications) typically offer more reliable performance .

What are the most effective methodologies for modulating MFN1 expression in research models?

Several approaches have proven effective for modulating MFN1 expression in research:

Genetic Knockdown/Knockout Strategies:

  • RNA interference using shRNA or siRNA targeting MFN1 transcripts has been successfully employed to silence MFN1 expression in various cell lines, including cancer cells .

  • CRISPR-Cas9-mediated gene editing has enabled the generation of MFN1 knockout models, including tissue-specific knockouts like cardiac-specific MFN1-deleted mice, which have revealed reduced systolic function and increased mitochondrial alterations .

MicroRNA-Based Approaches:

  • Several miRNAs naturally regulate MFN1 expression and can be leveraged experimentally. For example, miR-19b targets MFN1 through its 3'UTR sequences in osteosarcoma cells , while miR-142a-5p decreases MFN1 expression in atrophied gastrocnemius, causing mitochondrial fragmentation .

  • Plant-derived miR5338 has been shown to inhibit the expression of MFN1 in prostate cells .

Pharmacological Modulation:

  • CGP37157 (CGP), a blocker of mitochondrial calcium efflux, induces the ubiquitination of MFN1 through MARCH5 ubiquitin ligase, leading to its degradation by proteasomes .

  • MnTBAP (manganese-III-tetrakis (4-benzoic acid) porphyrin) stimulates the P13K/Akt/eNOS pathway in an MFN1-dependent manner .

How can researchers accurately assess MFN1-mediated mitochondrial fusion in cellular models?

Accurate assessment of MFN1-mediated mitochondrial fusion requires multi-parameter approaches:

Live-Cell Imaging Techniques:
Fluorescent protein-tagged mitochondria (such as using MitoTracker dyes or mitochondrially-targeted GFP/RFP) allow visualization of mitochondrial morphology changes . Time-lapse confocal microscopy can capture the dynamic process of mitochondrial clustering and subsequent fusion events mediated by MFN1 .

Ultrastructural Analysis:
Electron microscopy provides high-resolution images to evaluate structural changes in mitochondria, particularly useful for detecting the large mitochondria with deformed internal structure that appear when MFN1 causes fusion of outer mitochondrial membranes without affecting inner membranes .

Functional Assessments:
Beyond morphological changes, researchers should measure functional outcomes of MFN1-mediated fusion, including:

  • Mitochondrial membrane potential measurements using fluorescent probes like JC-1 or TMRM

  • Assessment of mitochondrial respiration capacity, which may increase in MFN1-deficient cells

  • Evaluation of reactive oxygen species production, which is elevated in certain MFN1 knockout models

Protein Interaction Analysis:
Co-immunoprecipitation can detect interactions between MFN1 and other proteins involved in the fusion machinery or regulatory pathways . GTPase activity assays specifically measuring MFN1 enzymatic function are essential since mutation at the K88 residue significantly diminishes its activity .

How does MFN1 function differ between normal and pathological states?

In normal physiological states, MFN1 maintains balanced mitochondrial dynamics by mediating fusion of outer mitochondrial membranes, supporting efficient energy production, and regulating apoptotic pathways . For example, in induced pluripotent stem cells (iPSCs), MFN1 induces mitochondrial fusion during neural differentiation .

In pathological states, MFN1 dysfunction manifests in context-specific ways:

Cancer contexts: MFN1 can act as either a tumor suppressor or oncogene depending on the cancer type . In HCC, downregulation of MFN1 is associated with poor prognosis, reduced E-cadherin expression, and enhanced metastatic potential . In contrast, in lung adenocarcinoma, MFN1 promotes high glucose-mediated epithelial-mesenchymal transition by regulating PINK-dependent autophagy .

Neurological disorders: In neural tissues, MFN1 deficiency leads to increased ROS production, altered glucose metabolism, and changes in neuronal activity . In Charcot-Marie-Tooth type 2A, abnormal MFN1/MFN2 ratios drive retinal degeneration through dysregulated autophagy/mitophagy .

Cardiovascular disease: In heart failure patients classified as "non-responders," MFN1 expression is significantly decreased, contributing to reduced systolic function and mitochondrial alterations . The βAR-cAMP-PKA-miR-140-5p signaling pathway negatively regulates MFN1 expression in this context .

This functional versatility suggests that therapeutic approaches targeting MFN1 must be highly context-specific and carefully calibrated to the particular pathological state.

What are the key protein interactions and regulatory mechanisms for MFN1?

MFN1 is regulated through multiple mechanisms and interacts with various proteins:

Protein-Protein Interactions:

  • MFN1 interacts with other MFN family proteins through its C-terminal coiled-coil and N-terminal G domains that face the cytoplasm .

  • It is regulated by MARCH5, an E3 ubiquitin ligase located in mitochondria that can bind to fusion proteins and target MFN1 for ubiquitination and subsequent proteasomal degradation .

  • In certain cancer contexts, MFN1 engages with the PKCα signaling pathway to enable mitochondrial tethering during cell division .

Post-translational Modifications:

  • Phosphorylation plays a critical role in MFN1 regulation. For example, phosphorylation at serine 86 by βIIPKC during subarachnoid hemorrhage impairs fusion and contributes to neuronal damage .

  • Ubiquitination of MFN1 through MARCH5 ubiquitin ligase leads to its degradation by proteasomes, as demonstrated with CGP37157 treatment in prostate cancer cells .

Transcriptional Regulation:

  • MicroRNAs are important regulators of MFN1 expression. miR-19b targets MFN1 through its 3'UTR sequences in osteosarcoma cells .

  • miR-142a-5p decreases MFN1 expression in atrophied gastrocnemius .

  • miR-140-5p is involved in βAR-cAMP-PKA-miR-140-5p signaling that negatively regulates MFN1 expression in cardiac tissue .

  • Plant-derived miR5338 inhibits MFN1 expression in prostate cells .

Understanding these interactions and regulatory mechanisms provides potential targets for therapeutic intervention in MFN1-associated diseases.

How does MFN1 influence cellular metabolic pathways?

MFN1 significantly influences cellular metabolism through its effects on mitochondrial dynamics and function:

Oxidative Phosphorylation (OXPHOS):
MFN1 deficiency can increase respiratory capacity in various cell types in a cell-autonomous manner . In cancer cells, MFN1 can shift the metabolic pathway from glycolysis to OXPHOS, which has been observed in hepatocellular carcinoma where this shift is attributed to MFN1-mediated fusion events . In acute myeloid leukemia, interleukin-6 upregulates MFN1-induced mitochondrial fusion, which activates OXPHOS and contributes to chemoresistance .

Glucose Metabolism:
In POMC neurons of the hypothalamic arcuate nucleus, impaired MFN1-associated mitochondrial fusion weakens glucose metabolism and affects the association between insulin release and POMC neurons through the sympathetic nervous system . Glucose challenge-mediated insulin secretion is diluted in POMC MFN1 knockout mice, though this response has a neural basis rather than reflecting changes in islet anatomy .

Reactive Oxygen Species (ROS) Production:
Loss of MFN1 in POMC neurons causes elevated ROS generation, altered mitochondrial respiration, and changes in neuronal activity . The increased ROS level in POMC MFN1 knockout mice appears to be independent of body weight fluctuations or appetite .

Glutathione Synthesis:
MFN1-mediated fusion processes can increase the synthesis of glutathione, which stimulates stem cell self-renewal . This has been observed in the context of epithelial-mesenchymal transition, where MFN1 upregulation is needed for PKCα-induced NUMB phosphorylation for cell division .

What are emerging therapeutic strategies targeting MFN1?

Several promising therapeutic strategies targeting MFN1 are emerging across different disease contexts:

Cancer-Targeted Approaches:
For cancers where MFN1 functions as an oncogene (like glioblastoma and lung adenocarcinoma), silencing MFN1 represents a potential therapeutic strategy . In glioblastoma, MFN1 silencing decreases hypoxia-inducible factor 1-alpha and phosphoinositide-dependent kinase 1 levels, suggesting potential therapeutic benefits .

For cancers where MFN1 acts as a tumor suppressor (like HCC and osteosarcoma), strategies to enhance MFN1 expression or block its inhibitors may be beneficial . In osteosarcoma, blocking miR-19b (which targets MFN1) or directly activating MFN1 shows anticancer effects .

MicroRNA-Based Therapies:
MicroRNAs that regulate MFN1 expression offer promising therapeutic targets . Plant-derived miR5338 has shown therapeutic effects for benign prostate hyperplasia by inhibiting MFN1 expression . Conversely, inhibiting miR-19b in osteosarcoma could enhance MFN1 expression and suppress tumor growth .

Neurological Disease Interventions:
In neurological disorders like Charcot-Marie-Tooth type 2A, transgenic expression of MFN1 improves vision and retinal morphology by restoring proper MFN1/MFN2 ratios . This suggests gene therapy approaches targeting MFN1 could benefit patients with mitochondrial dynamics-related neurological conditions.

Cardiovascular Disease Treatments:
For heart failure patients classified as "non-responders," strategies to enhance MFN1 expression could potentially improve cardiac function . MnTBAP, which has significant angiogenic effects through an MFN1-dependent pathway, represents a promising cardiovascular therapeutic agent .

What unresolved questions remain in understanding MFN1 biology?

Despite significant advances, several critical questions about MFN1 remain unanswered:

Tissue-Specific Functions:
While MFN1's role has been established in tissues like cardiac muscle, prostate, neurons, and various cancer types, its function in many other tissues remains poorly understood . The search results indicate a need for research on MFN1's role in other disease models and cell types to fully understand its therapeutic and diagnostic potential .

Regulatory Network Complexity:
The complete network of proteins and signaling pathways that regulate MFN1 expression and activity remains to be fully elucidated . For example, how different microRNAs coordinate to regulate MFN1 expression in different tissues, and how these regulatory mechanisms may be exploited therapeutically, requires further investigation.

Structure-Function Relationships:
While some structural elements of MFN1 have been characterized, such as its transmembrane regions and GTPase domain, the precise structural changes that occur during fusion events and how these are regulated by protein interactions and post-translational modifications need further study .

Therapeutic Targeting Specificity:
Given MFN1's context-dependent roles (tumor suppressor vs. oncogene; beneficial vs. detrimental in different diseases), developing therapeutic strategies with appropriate tissue and disease specificity represents a significant challenge . How to selectively target MFN1 in specific tissues or disease states without disrupting its necessary functions elsewhere remains an open question.

How might advanced technologies enhance our understanding of MFN1 function?

Emerging technologies offer new avenues for investigating MFN1 biology:

Cryo-Electron Microscopy:
This technique could provide high-resolution structural insights into MFN1 conformational changes during mitochondrial fusion, particularly the GTPase-dependent rearrangements of coiled-coil domains that facilitate membrane approximation . These structural details would enhance our understanding of MFN1's mechanistic role and potentially identify novel targets for therapeutic intervention.

Single-Cell Omics Technologies:
Single-cell RNA sequencing and proteomics could reveal cell-specific expression patterns and regulatory networks governing MFN1 function across different tissues and disease states . This would help explain the context-dependent roles of MFN1 in various diseases and cell types, potentially identifying novel biomarkers or therapeutic targets.

CRISPR-Based Screening:
Genome-wide CRISPR screens could identify novel regulators of MFN1 expression and function, as well as synthetic lethal interactions that could be exploited therapeutically, particularly in cancers where MFN1 is dysregulated . This approach might reveal unexpected connections between MFN1 and other cellular pathways, expanding our understanding of its role in health and disease.

Mitochondrial-Targeted Optogenetics:
Light-controlled activation or inhibition of MFN1 would enable precise temporal and spatial control over mitochondrial fusion events, allowing researchers to directly observe the consequences of MFN1 activation in living cells . This would provide unprecedented insights into the dynamics of MFN1-mediated fusion and its immediate effects on mitochondrial function and cellular metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.