Recombinant Human Monocyte to macrophage differentiation factor 2 (MMD2)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Production

Recombinant MMD2 is synthesized using heterologous expression platforms:

  • Escherichia coli: Cell-free systems yield soluble protein with high purity (>95%) .

  • Tobacco (Nicotiana tabacum): Plant-based systems enable scalable production with Strep Tag conjugation .

Functional Roles and Mechanisms

MMD2 regulates key signaling pathways through its Golgi apparatus localization :

  • Ras/ERK Signaling: Directly interacts with Ras proteins (HRas, NRas) to activate ERK/MAPK cascades, influencing cell differentiation and growth .

  • Akt Pathway: Enhances Akt phosphorylation, modulating macrophage TNF-α and nitric oxide (NO) production during LPS stimulation .

  • Developmental Regulation: Acts downstream of SOX9 in Sertoli cells during testis development and impacts muscle growth in Litopenaeus vannamei via myotrophin interactions .

Research Applications

ApplicationUtility
ELISA/Western BlotDetects endogenous MMD2 in human/mouse tissues using polyclonal antibodies (e.g., ABIN7160187) .
ImmunofluorescenceVisualizes Golgi-localized MMD2 in NIH3T3 cells .
Yeast Two-Hybrid AssaysIdentifies interactors like Ras, Rho, and myotrophin in shrimp growth pathways .
Transcriptional StudiesLinks MMD2 knockdown to immune gene upregulation (e.g., C-type lectins, ribonucleases) .

Key Research Findings

  1. Macrophage Activation: Overexpression of MMD2 amplifies LPS-induced TNF-α and NO production via ERK/Akt activation .

  2. Sex Determination: MMD2 expression in fetal mouse testes is SOX9-dependent, peaking at 15.5 dpc .

  3. Invertebrate Growth: In Litopenaeus vannamei, MMD2 isoforms (X1/X2) regulate molting, muscle development, and immunity through Ras/Hippo pathways .

  4. Epigenetic Modulation: Benzo[a]pyrene exposure increases MMD2 promoter methylation, altering its expression .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. This can serve as a reference for your own protocols.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
MMD2; PAQR10; Monocyte to macrophage differentiation factor 2; Progestin and adipoQ receptor family member 10; Progestin and adipoQ receptor family member X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MMD2
Target Protein Sequence
MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLS DDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYA PWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPAR YKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWH LFVAFGAGTHYYAIWRYLYLPSTLQTKVSK
Uniprot No.

Target Background

Gene References Into Functions
  1. This study unveils a novel paradigm for spatial regulation of Ras signaling within the Golgi apparatus, mediated by PAQR10 and PAQR11. PMID: 21968647
  2. Findings from this research indicate that Golgi localization is crucial for PAQR10 to effectively regulate its functions within the Ras signaling cascade. PMID: 22339580
  3. Genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20570966
  4. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
  5. Observational study of gene-disease association. (HuGE Navigator) PMID: 20237496
  6. Observational study of gene-disease association. (HuGE Navigator) PMID: 19240061

Show More

Hide All

Database Links

HGNC: 30133

OMIM: 614581

KEGG: hsa:221938

STRING: 9606.ENSP00000384690

UniGene: Hs.558694

Protein Families
ADIPOR family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Shows restricted expression with highest levels in brain and testis.

Q&A

What is MMD2 and what is its primary function in human biology?

MMD2 (Monocyte to Macrophage Differentiation factor 2) is a protein that plays a critical role in controlling monocyte-to-macrophage differentiation. It encodes a member of the progestin and adipoQ receptor (PAQR) family and contains a highly conserved seven-transmembrane motif . The primary function of MMD2 appears to be regulation of the differentiation process of monocytes into macrophages, with evidence suggesting it can suppress differentiation when highly expressed . MMD2 expression levels correlate with differentiation efficiency; studies have shown that knockdown of MMD2 (THP-ΔPPM1A) accelerates differentiation, while overexpression (THP-PPM1A) prevents maintenance of a stable differentiated phenotype .

How is MMD2 structurally characterized and conserved across species?

MMD2 belongs to the PAQR (Progestin and AdipoQ Receptor) family, specifically identified as PAQR10 in certain contexts. The protein contains a distinctive seven-transmembrane domain that is highly conserved across eukaryotes and some eubacteria . Phylogenetic analyses of MMD2 proteins from multiple species, including arthropods (crustaceans and insects), cnidarians, echinoderms, vertebrates, yeasts, and bacteria, demonstrate remarkable conservation particularly in the transmembrane regions . This high degree of evolutionary conservation suggests fundamental biological importance of MMD2 across diverse organisms. The conserved structure likely enables similar functional mechanisms across species, making comparative studies particularly valuable for understanding fundamental aspects of its biology.

What expression patterns does MMD2 exhibit in different human tissues?

While comprehensive human tissue expression data is limited in the provided research, studies in other organisms provide insights that may parallel human patterns. In the Pacific white shrimp (Litopenaeus vannamei), LvMmd2 was found to be widely expressed across different tissues, with notably high expression in the eye stalk . In human studies focusing on immune cells, PPM1A (which controls MMD2) showed differential expression during monocyte differentiation induced by different stimuli. For instance, GM-CSF stimulation resulted in dramatic increases in PPM1A expression, while M-CSF stimulation produced only modest 2-fold increases by day 11 post-differentiation . This suggests tissue-specific and stimulus-dependent regulation of MMD2 expression, particularly in immune cell populations.

How do transcription factors regulate monocyte differentiation pathways and what role does MMD2 play in this process?

Recent research has identified distinct transcription factors that control the divergent pathways of monocyte differentiation into either macrophages (mo-Mac) or dendritic cells (mo-DC). These pathways represent alternative cell fates rather than sequential stages .

Key transcription factors include:

  • IRF1: Essential for mo-Mac differentiation, functioning independently of its role in regulating interferon-stimulated genes. IRF1 shows higher expression in macrophage-engaged cell clusters .

  • ZNF366: More highly expressed in DC-committed clusters. The mouse ortholog is involved in classical DC1 terminal differentiation .

  • MAFF: Shows complex regulation, with higher expression in macrophage-committed clusters but plays a role in mo-DC differentiation. Silencing MAFF decreases mo-DC differentiation without affecting mo-Mac proportions .

MMD2's role appears to be upstream of these transcription factors, potentially functioning as an early regulator that influences which differentiation pathway monocytes will follow. The fate decision between these pathways occurs within the first 24 hours of differentiation, and MMD2 expression levels may be critical during this period .

What genetic mutations in MMD2 have been identified and what are their pathological consequences?

A significant MMD2 mutation (A116V) has been identified in connection with aggressive periodontitis associated with neutropenia, representing a newly characterized immune system defect . To investigate the functional consequences of this mutation, researchers developed a knock-in mouse model carrying an amino acid substitution in Mmd2 (A117V) corresponding to the human A116V mutation .

The pathological consequences include:

  • Severe alveolar bone loss, consistent with the periodontitis phenotype observed in human patients

  • Altered immune cell function, particularly affecting neutrophil homeostasis

  • Dysregulated monocyte-to-macrophage differentiation, potentially contributing to abnormal inflammatory responses

This mutation likely affects the structure and function of the MMD2 protein, potentially altering its transmembrane configuration or interaction with signaling partners, ultimately disrupting proper immune cell differentiation and function .

How does MMD2 expression change during different stimulation conditions in monocyte differentiation?

MMD2 expression is dynamically regulated during monocyte differentiation, with patterns varying significantly depending on the stimulating agent. Research indicates:

  • GM-CSF stimulation induces a dramatic increase in PPM1A expression (which controls MMD2 expression)

  • M-CSF stimulation results in a more modest 2-fold increase in PPM1A by day 11 post-differentiation

  • Different toll-like receptor (TLR) ligands produce distinctive effects on PPM1A/MMD2 expression:

    • Imiquimod or Pam3CSK4 treatment transforms monocytes into elongated cell shapes resembling alternatively activated macrophages

    • PMA-induced differentiation shows different kinetics in cells with varied PPM1A/MMD2 levels

These differential expression patterns suggest MMD2 plays variable roles depending on the inflammatory or homeostatic context. The time course of expression changes is also significant, with critical regulation occurring within 24-72 hours of stimulation .

What are the optimal approaches for studying MMD2 function through gene silencing or overexpression?

Based on successful methodologies reported in the literature, researchers can employ several approaches to study MMD2 function:

RNA Interference (RNAi):

  • shRNA-mediated knockdown: Generate stable cell lines with decreased MMD2 expression using short hairpin RNA targeting MMD2 mRNA

  • siRNA transient transfection: For shorter-term experiments examining acute effects of MMD2 reduction

  • dsRNA injection: Particularly effective in model organisms such as shrimp, where direct injection of double-stranded RNA targeting MMD2 has been shown to significantly alter growth rates

Overexpression Systems:

  • Lentiviral vectors: Generate stable overexpressing cell lines (e.g., THP-PPM1A) for long-term studies of MMD2 function

  • Inducible expression systems: Create doxycycline-responsive overexpression to allow temporal control of MMD2 levels

Validation Methods:

  • Western blot analysis at different time points following manipulation to confirm protein level changes

  • qRT-PCR to verify mRNA expression alterations

  • Functional assessments specific to the model system (e.g., cell adherence indices, differentiation marker expression)

Experimental Design Considerations:

  • Include appropriate controls (scrambled RNA, empty vector)

  • Examine multiple time points (especially 24h, 48h, and 72h post-manipulation)

  • Assess both molecular (gene expression) and functional (differentiation, morphology) outcomes

What are the recommended approaches for phenotypic evaluation of MMD2 function in monocyte-to-macrophage differentiation?

Several validated methodologies have been employed to assess the phenotypic impact of MMD2 on monocyte differentiation:

Real-Time Cell Analysis (RTCA):

  • Measures changes in electrical impedance (Cell Index) as monocytes adhere and differentiate

  • Provides continuous, label-free monitoring of differentiation

  • Cell Index positively correlates with expression of macrophage markers (CD68, CD80, CD86)

Flow Cytometry Analysis:

  • Assess surface marker expression including:

    • CD68, CD80, CD86 (macrophage markers)

    • MHC class I and II (HLA-A,B,C and HLA-DR)

    • CCR5/CD195 (upregulated during differentiation)

    • CD1a (mo-DC marker)

    • CD16 (can distinguish subpopulations)

Morphological Assessment:

  • Bright-field microscopy to document changes in cell shape (elongation, adherence)

  • May reveal specific morphologies associated with alternatively activated macrophages

Transcriptome Analysis:

  • Single-cell RNA sequencing to identify differentiation trajectories

  • Bulk RNA sequencing to identify differentially expressed genes

  • Computational approaches like DoRoThEa to predict transcription factor activity

Functional Assays:

  • Phagocytosis capacity

  • Cytokine production in response to stimuli

  • Cell migration assays

What mixed-methods research designs are most appropriate for investigating MMD2's role in disease contexts?

Investigating MMD2 in disease contexts benefits from mixed-methods research (MMR) approaches that combine quantitative and qualitative methodologies. Based on the literature, the following mixed-methods designs are recommended:

Sequential Explanatory Design:

  • Begin with quantitative measurement of MMD2 expression in patient samples

  • Follow with qualitative molecular approaches to explore mechanisms

  • Suitable for exploring MMD2's role in conditions like aggressive periodontitis

Convergent Parallel Design:

  • Simultaneously collect quantitative data (e.g., MMD2 expression levels) and qualitative data (e.g., patient symptoms, disease progression)

  • Analyze datasets separately then compare results

  • Particularly useful for clinical studies examining MMD2 mutations

Embedded Experimental Design:

  • Embed qualitative data collection within a primarily quantitative experimental study

  • Example: Collect transcriptomic data from MMD2 knockdown experiments while also performing detailed morphological assessments and immunophenotyping

  • Adds contextual understanding to quantitative outcomes

Implementation Considerations:

  • Address common methodological issues through:

    • Clear articulation of research questions

    • Appropriate integration of quantitative and qualitative data

    • Proper selection of error terms for statistical analysis

  • Report using established MMR frameworks, ensuring both quantitative and qualitative findings are adequately presented

What statistical approaches should be used for analyzing complex MMD2 experimental designs?

When analyzing complex experimental designs involving MMD2, researchers should consider:

Random Effects Models:
For multi-phase or nested designs, random effects models are essential to account for the complex error structure. These models should:

  • Identify appropriate error terms for each factor at various experimental stages

  • Account for potential block-treatment interactions between phases

  • Examine variance component terms in expected mean squares (EMSs)

Example of Analysis Approach for a Three-Factor Design:
When examining the effects of multiple factors (e.g., Treatment, Environment, and Method) on MMD2 expression or function:

Source of VariationDegrees of FreedomExpected Mean SquareF-ratio
Treatment (T)t-1σ² + rσ²ᵀₑ + reσ²ᵀMS(T)/MS(T×E)
Environment (E)e-1σ² + rσ²ᵀₑ + rtσ²ᴱMS(E)/MS(T×E)
Method (M)m-1σ² + σ²ᵀₑₘ + teσ²ᴹMS(M)/MS(T×E×M)
T × E(t-1)(e-1)σ² + rσ²ᵀₑMS(T×E)/MS(Error)
T × M(t-1)(m-1)σ² + eσ²ᵀₘMS(T×M)/MS(T×E×M)
E × M(e-1)(m-1)σ² + tσ²ᴱₘMS(E×M)/MS(T×E×M)
T × E × M(t-1)(e-1)(m-1)σ² + σ²ᵀₑₘMS(T×E×M)/MS(Error)
Errorte(r-1)σ²-

This approach ensures proper identification of interaction effects that might otherwise be obscured by inappropriate error term selection .

Special Considerations for MMD2 Studies:

  • Account for time-dependent changes in MMD2 expression using longitudinal data analysis

  • Employ clustering methods for cell population analysis when studying differentiation

  • Use appropriate normalization methods for gene expression data

How can transcriptomic data be effectively analyzed to understand MMD2's regulatory networks?

To effectively analyze transcriptomic data for understanding MMD2's regulatory networks:

Computational Approaches:

  • DoRoThEa Analysis: This method has been successfully used to identify transcription factors involved in monocyte differentiation pathways, including those potentially regulated by or regulating MMD2

  • Differential Expression Analysis:

    • Identify differentially expressed genes (DEGs) between control and MMD2-manipulated conditions

    • In shrimp studies, 422 DEGs were identified after MMD2 knockdown, with 337 genes upregulated, including numerous muscle-related and protein synthesis genes

  • Single-Cell RNA Sequencing Analysis:

    • Cluster analysis to identify cell populations at different differentiation stages

    • Trajectory inference to map differentiation pathways

    • In monocyte differentiation studies, this approach identified distinct clusters representing divergent paths toward macrophage or dendritic cell fates

Network Analysis Strategies:

  • Gene Ontology and pathway enrichment analysis to identify biological processes affected by MMD2

  • Protein-protein interaction network construction to identify direct binding partners

  • Gene regulatory network inference to establish transcriptional hierarchies

Validation Approaches:

  • Chromatin immunoprecipitation (ChIP) to confirm direct regulation

  • Reporter assays to validate promoter interactions

  • Targeted gene expression analysis of key pathway components

By combining these approaches, researchers can establish comprehensive models of MMD2's position in regulatory networks controlling monocyte differentiation, growth processes, and immune function .

What are the potential therapeutic applications of targeting MMD2 in inflammatory or immune-related disorders?

Based on MMD2's role in monocyte differentiation and immune function, several promising therapeutic directions emerge:

Potential Clinical Applications:

  • Inflammatory Disorders:

    • Targeting MMD2 could modulate the balance between macrophage and dendritic cell populations

    • This approach may be particularly relevant for chronic inflammatory conditions where macrophage dysregulation is implicated

  • Periodontitis Treatment:

    • The identification of MMD2 A116V mutation in aggressive periodontitis with neutropenia suggests that MMD2-targeted therapies could address underlying immune dysregulation

    • Approaches might include small molecule modulators of MMD2 function or gene therapy to correct pathogenic mutations

  • Cancer Immunotherapy:

    • Manipulating monocyte differentiation through MMD2 modulation could enhance antitumor immune responses

    • Specifically, promoting dendritic cell differentiation could improve antigen presentation and T cell activation

Therapeutic Strategies:

  • Small Molecule Approaches:

    • Development of compounds that modulate MMD2 activity

    • Design considerations should account for the seven-transmembrane structure of MMD2

  • RNA-Based Therapeutics:

    • siRNA or antisense oligonucleotides to temporarily reduce MMD2 expression

    • This approach has shown growth-promoting effects in animal models, suggesting applications beyond immune disorders

  • Gene Editing Approaches:

    • CRISPR-Cas9 could potentially correct pathogenic MMD2 mutations

    • The mouse model with Mmd2 A117V mutation provides a platform for testing such approaches

Considerations for Translation:

  • Tissue-specific effects of MMD2 modulation must be considered

  • Timing of intervention may be critical, given the early fate decisions in monocyte differentiation (within 24h)

  • Long-term consequences of altering MMD2 expression require careful evaluation

How might MMD2 be utilized as a biomarker for immune cell differentiation status in research and clinical applications?

MMD2 shows promise as a biomarker for immune cell differentiation status in both research and clinical contexts:

Research Applications:

  • Differentiation Stage Indicator:

    • MMD2 expression levels correlate with monocyte differentiation status

    • Changes in expression can mark critical transition points in differentiation trajectories

  • Quality Control for Cell-Based Therapies:

    • Monitoring MMD2 expression could help standardize monocyte-derived cell products

    • Particularly relevant for dendritic cell-based vaccines where consistent differentiation is critical

  • Experimental Readout:

    • MMD2 expression can serve as a molecular readout for differentiation studies

    • Changes in expression correlate with functional and morphological alterations

Clinical Biomarker Potential:

  • Inflammatory Disease Assessment:

    • Altered MMD2 expression patterns might indicate dysregulated myeloid differentiation in inflammatory conditions

    • Could potentially distinguish between different types of inflammatory responses

  • Treatment Response Monitoring:

    • Changes in MMD2 expression following therapy might predict or indicate treatment efficacy

    • Particularly relevant for therapies targeting monocyte/macrophage function

  • Risk Stratification:

    • MMD2 mutations or expression patterns could help identify patients at risk for specific immune-related disorders

    • The A116V mutation demonstrates how MMD2 variants can predict disease susceptibility

Methodological Considerations:

  • Detection Methods:

    • qRT-PCR for mRNA quantification

    • Flow cytometry if suitable antibodies are available

    • Single-cell approaches for heterogeneous populations

  • Reference Ranges:

    • Establishment of normal expression ranges for different tissues and conditions

    • Consideration of stimulus-dependent expression variability

  • Combining with Other Markers:

    • Greatest utility may come from incorporating MMD2 into biomarker panels

    • Integration with established markers like CD68, CD80, CD86, and HLA-DR

What are the most promising avenues for future MMD2 research?

Based on current understanding, several high-priority research directions emerge:

Fundamental Biology:

  • Structure-Function Relationships:

    • Determine the three-dimensional structure of MMD2, particularly focusing on the seven-transmembrane domains

    • Identify critical binding partners and signaling pathways

    • Investigate how the A116V mutation alters protein structure and function

  • Regulatory Mechanisms:

    • Elucidate transcriptional and post-transcriptional regulation of MMD2

    • Identify factors controlling tissue-specific expression patterns

    • Investigate epigenetic modifications affecting MMD2 expression

  • Evolutionary Studies:

    • Further comparative analyses across species to understand conserved functions

    • Investigate species-specific adaptations of MMD2 function

Applied Research:

  • Disease-Association Studies:

    • Expand investigations of MMD2 mutations in other immune-related disorders

    • Conduct population-based studies to identify additional disease-associated variants

    • Explore potential connections to metabolic disorders given growth-related effects

  • Therapeutic Development:

    • Design and test small molecule modulators of MMD2 function

    • Develop RNA-based approaches for transient manipulation

    • Create cell-based therapies with optimized MMD2 expression

  • Diagnostic Applications:

    • Develop standardized assays for measuring MMD2 expression

    • Establish MMD2 as part of biomarker panels for inflammatory conditions

    • Create point-of-care testing for relevant MMD2 variants

Methodological Innovations:

  • Single-Cell Multi-Omics:

    • Integrate transcriptomic, epigenomic, and proteomic analyses at single-cell level

    • Map temporal changes during differentiation with high resolution

    • Identify cell state transitions where MMD2 plays critical roles

  • Advanced In Vivo Models:

    • Develop tissue-specific and inducible Mmd2 knockout/knockin models

    • Utilize humanized mouse models to better translate findings

    • Explore models of MMD2-associated diseases

  • Systems Biology Approaches:

    • Create comprehensive regulatory network models incorporating MMD2

    • Develop predictive mathematical models of monocyte differentiation

    • Integrate multi-scale data from molecular to organismal levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.