Recombinant Human Monocyte to macrophage differentiation protein (MMD)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant MMD is synthesized using diverse systems to optimize purification and functional studies:

Host SystemTag/ConjugatePurity (%)ApplicationsSource
Wheat GermGST>97%Western Blot, ELISA, Antibody Arrays
E. coliHis>97%SDS-PAGE, Immunoassays
Tobacco (N. tabacum)Strep>80%ELISA, WB, SEC (HPLC)
Mammalian Cells (HEK293)Avi/FcN/AReceptor studies, IP

Note: Wheat germ and E. coli systems are preferred for high-purity recombinant MMD .

Functional Roles in Macrophage Biology

MMD is upregulated during monocyte-to-macrophage differentiation and influences inflammatory responses:

Differentiation and Activation

  • Expression Profile: Undetectable in fresh monocytes; highly expressed in differentiated macrophages .

  • LPS Stimulation: MMD expression increases upon lipopolysaccharide (LPS) exposure, modulated by Notch signaling (RBP-J transcription factor) .

Signaling Pathways

MMD amplifies pro-inflammatory cytokines via ERK1/2 and Akt pathways:

PathwayEffect of MMD OverexpressionDownstream Outcome
ERK1/2Phosphorylation ↑TNF-α production ↑
AktPhosphorylation ↑NO production ↑
Inhibition (e.g., Erk/Akt blockers)TNF-α/NO ↓ in MMD-overexpressing cells

Research Applications and Tools

MMD is utilized in immunological and biochemical assays:

Detection Methods

Assay TypeReagents/ToolsSensitivity/RangeSource
ELISASandwich-based kit (HUDL01868)0.061–10 ng/mL (Human)
Western BlotGST/His-tagged proteinsFull-length (27 kDa)
IP/ICCRabbit polyclonal antibodiesWB, IHC, IP validated

Functional Studies

  • Lysosomal Dynamics: MMD associates with lysosomal membranes during microglial activation post-brain injury .

  • Therapeutic Targeting: Modulating MMD may regulate TNF-α/NO levels in inflammatory diseases .

Key Research Findings

  1. MMD and Macrophage Activation: Overexpression enhances LPS-induced TNF-α and NO production via ERK/Akt .

  2. Subcellular Localization: Colocalizes with ER, mitochondria, and Golgi but not lysosomes .

  3. Species-Specific Variants: Mouse MMD (Q9CQY7) shares structural homology with human MMD .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
MMD; PAQR11; Monocyte to macrophage differentiation factor; Progestin and adipoQ receptor family member 11; Progestin and adipoQ receptor family member XI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MMD
Target Protein Sequence
MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
Uniprot No.

Target Background

Function
Monocyte to macrophage differentiation protein (MMD) plays a crucial role in regulating the dynamics of lysosomal membranes within microglia, particularly during brain lesion activation.
Gene References Into Functions
  1. Elevated PAQR11 levels have been associated with epithelial-to-mesenchymal transition (EMT) and reduced survival in human cancers. Studies have shown PAQR11 to be essential for tumor cell migration and metastasis in EMT-driven lung adenocarcinoma models. PMID: 27869652
  2. Research indicates that the miR-140-5p/MMD axis is a significant factor in lung cancer development, and this axis could potentially be targeted for therapeutic interventions against lung cancer. PMID: 24971538
  3. Recent findings reveal a novel mechanism for spatial regulation of Ras signaling within the Golgi apparatus, mediated by PAQR10 and PAQR11. PMID: 21968647
Database Links

HGNC: 7153

OMIM: 604467

KEGG: hsa:23531

STRING: 9606.ENSP00000262065

UniGene: Hs.463483

Protein Families
ADIPOR family
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Exhibits relatively ubiquitous expression with preferential expression in mature (in vitro differentiated) macrophages.

Q&A

What is Monocyte to Macrophage Differentiation Protein (MMD)?

MMD is a protein belonging to the PAQR (Progestin and AdipoQ Receptor) family that plays a regulatory role in macrophage activation and inflammatory responses. It is significantly upregulated during the process of monocyte differentiation into macrophages, suggesting its critical involvement in this cellular transition. MMD has been identified as a modulator of macrophage-mediated immune responses, particularly in the context of inflammation following pathogenic stimulation .

What is the subcellular localization of MMD protein?

Within cells, MMD demonstrates specific subcellular distribution patterns that provide insight into its functional mechanisms. Studies using EGFP-MMD fusion proteins have demonstrated that MMD can be co-localized to multiple organelles including the endoplasmic reticulum, mitochondria, and Golgi apparatus. Notably, MMD is absent from lysosomes and the cytoplasm, suggesting organelle-specific functions. This localization pattern may be critical for MMD's ability to modulate signaling pathways involved in macrophage activation .

How is MMD expression regulated during monocyte-to-macrophage differentiation?

MMD expression undergoes significant upregulation during the differentiation of monocytes into macrophages. This process appears to be further enhanced upon macrophage activation with stimuli such as lipopolysaccharide (LPS). Research suggests that this regulation might be modulated by RBP-J, a critical transcription factor in the Notch signaling pathway. The temporal expression pattern of MMD during differentiation indicates its potential role as a biomarker for macrophage maturation status .

Stage of DifferentiationRelative MMD ExpressionKey Regulators
Monocytes (baseline)LowUnknown
Differentiating monocytesIncreasingPossibly RBP-J
Mature macrophagesHighRBP-J
LPS-activated macrophagesVery highRBP-J and LPS-induced factors

What are the molecular mechanisms by which MMD influences macrophage activation?

MMD exerts its effects on macrophage activation through multiple signaling pathways, with particular emphasis on the ERK1/2 and Akt signaling cascades. Research has demonstrated that MMD overexpression enhances the phosphorylation of both ERK1/2 and Akt in macrophages following LPS stimulation. This enhanced signaling directly correlates with increased production of inflammatory mediators such as TNF-α and nitric oxide (NO). Pharmacological inhibition studies have further clarified this relationship, showing that blocking ERK reduces TNF-α production while Akt inhibition diminishes NO production in MMD-overexpressing macrophages .

The pathway specificity suggests that MMD may differentially regulate distinct aspects of macrophage activation rather than acting as a general amplifier of inflammatory responses. This nuanced regulatory capacity makes MMD a potentially valuable target for therapeutic interventions aimed at modulating specific inflammatory outcomes without global immunosuppression.

What is the relationship between MMD and Notch signaling in macrophage function?

The regulation of MMD expression by RBP-J, a critical transcription factor in the Notch signaling pathway, suggests an important intersection between MMD function and Notch signaling in macrophages . This relationship may represent a novel regulatory mechanism controlling macrophage activation states.

Notch signaling is known to influence multiple aspects of macrophage biology, including differentiation, polarization, and inflammatory responses. The modulation of MMD expression by RBP-J suggests that MMD may serve as a downstream effector of Notch signaling specifically in the context of macrophage activation. This creates a potential signaling axis: Notch → RBP-J → MMD → ERK1/2/Akt → inflammatory mediators (TNF-α/NO).

What are optimal protocols for studying MMD function in macrophage biology?

To effectively study MMD function in macrophage biology, researchers should consider implementing the following methodological approaches:

  • Cell Source and Differentiation: Isolate CD14+ monocytes from peripheral blood mononuclear cells (PBMCs) using magnetic cell selection techniques. Culture these cells in macrophage differentiation media containing appropriate cytokines such as GM-CSF for M1-like differentiation .

  • MMD Manipulation: Employ genetic approaches to modulate MMD expression:

    • Overexpression using lentiviral or plasmid vectors containing the MMD gene

    • Knockdown using siRNA or shRNA targeting MMD

    • CRISPR/Cas9-mediated gene editing for complete knockout studies

  • Activation Protocols: Stimulate macrophages with well-characterized activators:

    • LPS (100 ng/mL) for classical activation

    • Cytokine combinations (e.g., IL-4/IL-13) for alternative activation

  • Readout Measures:

    • Flow cytometry to assess surface markers (CD14, CD80, CD163, CD206)

    • ELISA for cytokine production (TNF-α, IL-12, IL-10)

    • Griess assay for NO production

    • Western blotting for signaling pathway analysis (phospho-ERK1/2, phospho-Akt)

    • RT-qPCR for gene expression analysis

How can researchers effectively quantify changes in MMD expression?

Accurate quantification of MMD expression changes requires multiple complementary approaches:

  • Transcriptional Analysis:

    • RT-qPCR using validated primers specific to MMD

    • RNA-seq for genome-wide expression analysis and pathway integration

    • Single-cell RNA-seq to assess heterogeneity in expression across cell populations

  • Protein-Level Analysis:

    • Western blotting with specific anti-MMD antibodies

    • Flow cytometry for single-cell protein expression analysis

    • Immunofluorescence microscopy to visualize subcellular localization

  • Temporal Considerations:

    • Time-course experiments to capture dynamic changes during differentiation

    • Pulse-chase studies to assess protein stability and turnover

Analysis MethodAdvantagesLimitationsBest Applications
RT-qPCRHigh sensitivity, quantitativeDoesn't reflect protein levelsRapid screening, time-course studies
Western blotProtein-level information, size verificationSemi-quantitative, population averageProtein expression, post-translational modifications
Flow cytometrySingle-cell resolution, high throughputRequires specific antibodiesHeterogeneity analysis, multi-parameter studies
ImmunofluorescenceSubcellular localization, morphological contextLow throughputLocalization studies, co-localization analysis

What experimental controls are essential when studying MMD in macrophage activation?

When designing experiments to investigate MMD's role in macrophage activation, the following controls are essential for rigorous scientific inquiry:

  • Expression Controls:

    • Empty vector controls for overexpression studies

    • Non-targeting siRNA/shRNA for knockdown experiments

    • Wild-type cells alongside genetically modified cells

  • Activation Controls:

    • Unstimulated cells (negative control)

    • Cells treated with established activators like LPS (positive control)

    • Appropriate time-matched controls for time-course experiments

  • Signaling Pathway Controls:

    • Pharmacological inhibitors of ERK1/2 (e.g., U0126, PD98059) and Akt (e.g., MK-2206)

    • Positive controls for pathway activation (e.g., PMA for ERK1/2)

  • Phenotypic Controls:

    • Well-characterized M1 and M2 macrophage populations for polarization studies

    • Reference cell lines with stable phenotypes

How should researchers interpret MMD-mediated changes in macrophage signaling?

When analyzing MMD-mediated changes in macrophage signaling, researchers should consider:

  • Temporal Dynamics: The timing of signaling events is crucial. ERK1/2 phosphorylation typically occurs rapidly (minutes to hours) after stimulation, while downstream transcriptional changes may take hours to manifest. MMD overexpression has been shown to enhance ERK1/2 and Akt phosphorylation following LPS stimulation, suggesting it amplifies early signaling events .

  • Pathway Specificity: MMD appears to have differential effects on distinct signaling pathways. Research indicates that MMD-enhanced TNF-α production involves ERK1/2 signaling, while NO production is more dependent on the Akt pathway . This specificity should be considered when interpreting experimental results.

  • Functional Outcomes: Beyond phosphorylation events, researchers should correlate signaling changes with functional outcomes such as cytokine production, phagocytic capacity, and microbicidal activity to establish the biological relevance of observed signaling alterations.

  • Integration with Other Pathways: MMD's interaction with RBP-J suggests connections to Notch signaling . Comprehensive analysis should consider cross-talk between multiple signaling networks rather than viewing each pathway in isolation.

What approaches can distinguish between direct and indirect effects of MMD on macrophage function?

Distinguishing between direct and indirect effects of MMD on macrophage function requires sophisticated experimental approaches:

  • Temporal Resolution Studies:

    • High-resolution time-course experiments can help establish cause-effect relationships

    • Rapid responses (seconds to minutes) after MMD manipulation suggest direct effects

    • Delayed responses (hours) may indicate indirect effects requiring intermediate steps

  • Proximity-Based Methods:

    • Proximity ligation assays to detect physical interactions between MMD and signaling components

    • BioID or APEX2-based proximity labeling to identify proteins in close association with MMD

  • Reconstitution Experiments:

    • Cell-free systems with purified components to test direct biochemical interactions

    • Structure-function analysis using MMD mutants to identify critical functional domains

  • Transcriptional Profiling:

    • RNA-seq analysis with and without protein synthesis inhibitors (e.g., cycloheximide) to distinguish primary vs. secondary transcriptional responses

    • ChIP-seq to identify direct transcriptional targets of factors downstream of MMD

How can researchers reconcile contradictory findings regarding MMD's inflammatory effects?

When faced with seemingly contradictory findings regarding MMD's role in inflammation, researchers should consider:

What are promising therapeutic applications targeting MMD in inflammatory diseases?

Given MMD's role in macrophage activation and inflammatory responses, several therapeutic applications warrant investigation:

  • Targeted Inhibition for Inflammatory Disorders: Developing specific inhibitors of MMD function could potentially modulate excessive macrophage activation in conditions such as:

    • Autoimmune diseases (rheumatoid arthritis, inflammatory bowel disease)

    • Atherosclerosis and cardiovascular inflammation

    • Neuroinflammatory conditions

  • Enhancement for Antimicrobial Immunity: Conversely, strategies to enhance MMD function might boost protective innate immune responses against:

    • Intracellular bacterial infections

    • Chronic viral infections

    • Opportunistic fungal pathogens

  • Cell-Based Therapies: Manipulation of MMD expression in macrophages ex vivo could generate optimized therapeutic cells for:

    • Cancer immunotherapy (enhanced anti-tumor activity)

    • Tissue repair and regeneration

    • Resolution of chronic inflammation

What emerging technologies can advance our understanding of MMD biology?

Several cutting-edge technologies show promise for elucidating MMD biology:

  • Single-Cell Technologies:

    • Single-cell RNA-seq to reveal heterogeneity in MMD expression and responses

    • Single-cell proteomics to correlate MMD with protein networks at individual cell level

    • Single-cell metabolomics to link MMD to metabolic reprogramming

  • Advanced Imaging:

    • Super-resolution microscopy for precise subcellular localization

    • Live-cell imaging with fluorescent reporters to track dynamic MMD-dependent processes

    • Correlative light and electron microscopy for ultrastructural context

  • Systems Biology Approaches:

    • Multi-omics integration to place MMD within comprehensive cellular networks

    • Mathematical modeling of MMD-influenced signaling dynamics

    • Network analysis to identify novel MMD-interacting components

  • In Vivo Models:

    • Tissue-specific and inducible MMD knockout mice

    • Humanized mouse models to study human MMD in physiological context

    • Intravital imaging to observe MMD-dependent macrophage functions in living tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.