Recombinant Human Motile sperm domain-containing protein 2 (MOSPD2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOSPD2; Motile sperm domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
MOSPD2
Target Protein Sequence
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
Uniprot No.

Target Background

Function

MOSPD2 (Motile sperm domain-containing protein 2) is an endoplasmic reticulum-anchored receptor that regulates interorganelle contacts. It interacts with other organelle-bound proteins via their FFAT motif, playing a significant role in endoplasmic reticulum-endosome interactions. MOSPD2 also promotes the migration of primary monocytes and neutrophils in response to various chemokines.

Gene References Into Functions
  1. This study demonstrates that MOSPD2 silencing inhibits signaling pathways following chemokine receptor ligation and reduces chemokine-induced monocyte migration. PMID: 28137892
Database Links

HGNC: 28381

KEGG: hsa:158747

STRING: 9606.ENSP00000369860

UniGene: Hs.744919

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
Tissue Specificity
Highly expressed in CD14(+) monocytes, and at lower levels in neutrophils. Does not show significant expression in B-cells or T-cells.

Q&A

Basic Research Questions

  • What is the structural composition of MOSPD2?

    Human MOSPD2 is a 518 amino acid protein containing a cellular retinaldehyde binding protein (CRAL)-TRIO domain and a predicted transmembrane region at position 497-517 . The protein contains a motile sperm (MSP) domain that structurally resembles the MSP domains found in VAP-A and VAP-B, enabling it to bind to FFAT motifs with micromolar affinity (KD values between 0.6-0.7 μM) . The MSP domain of MOSPD2 functions as a bona fide FFAT motif-interacting domain, and mutations in this domain (such as R404D/L406D) can disrupt its binding capacity . Understanding this domain structure is essential for designing experimental inhibitors that target specific protein-protein interactions.

  • What is the cellular distribution of MOSPD2 across immune cell types?

    MOSPD2 displays a distinctive pattern of expression across immune cell lineages. The protein is predominantly expressed on the cytoplasmic membrane of CD14+ human monocytes and is also detected, though less abundantly, in neutrophils . Notably, MOSPD2 is absent in lymphocytes . This cell-specific expression pattern suggests that MOSPD2 plays a specialized role in myeloid cell function, particularly in cell migration. When investigating MOSPD2 in experimental models, researchers should consider this restricted expression pattern when selecting appropriate cell types for study.

  • What is the subcellular localization of MOSPD2?

    MOSPD2 primarily functions as an endoplasmic reticulum (ER)-resident protein . Within this context, MOSPD2 is enriched at membrane contact sites (MCS) where the ER interfaces with other organelles, including endosomes, mitochondria, and the Golgi apparatus . This localization is facilitated by MOSPD2's ability to interact with FFAT motif-containing proteins on target organelles. For immunofluorescence studies, MOSPD2 appears as a reticular pattern consistent with ER localization, and can be visualized at punctate structures representing membrane contact sites where other organelle markers are also present.

  • How does MOSPD2 expression correlate with cancer progression?

    MOSPD2 shows a striking correlation with cancer progression, particularly in breast cancer. Analysis of tumor microarrays has revealed that MOSPD2 is detected in the majority of cancerous tissues at concentrations higher than those found in normal tissue . In breast cancer specifically, the prevalence of MOSPD2 increases with disease progression - from 63% positivity in locally-confined primary tumors to 77% in invasive carcinoma, and 81% in metastatic invasive ductal carcinoma . This trend suggests that MOSPD2 expression may be associated with the transition of breast cancer cells from being locally restricted to becoming invasive. Data mining from the Human Protein Atlas and TCGA databases further indicates that MOSPD2 RNA is detected across all cancer types, and its expression inversely correlates with patient survival .

  • What experimental methods are available for detecting MOSPD2?

    Researchers can detect MOSPD2 using various techniques:

    • Western Blot: Using specific anti-MOSPD2 monoclonal antibodies. Samples should be lysed in buffer containing DTT, phosphatase and protease inhibitors .

    • Immunohistochemistry: For tissue microarrays and clinical samples, comparing staining with control antibodies to determine specificity .

    • Quantitative Immunoblotting: To measure absolute protein levels, using recombinant proteins as standards. This approach has revealed that in HeLa cells, MOSPD2 is approximately 200 times less abundant than VAP-A .

    • Immunofluorescence Microscopy: For subcellular localization studies, often combined with markers for other organelles to identify membrane contact sites .

Advanced Research Questions

  • What are the mechanisms by which MOSPD2 regulates monocyte migration?

    MOSPD2 plays a crucial role in the chemokine-induced migration of monocytes through multiple mechanisms:

    • Chemokine Receptor Signaling: Silencing or neutralizing MOSPD2 in monocytes restricts their migration in response to different chemokines by inhibiting signaling events following chemokine receptor ligation . This suggests MOSPD2 acts as a common downstream regulator for multiple chemokine receptors.

    • Phosphorylation Events: MOSPD2 appears to be involved in phosphorylation cascades that are essential for cell migration. In breast cancer cells, silencing MOSPD2 profoundly abates phosphorylation events involved in chemotaxis , suggesting a similar mechanism may operate in monocytes.

    For researchers investigating monocyte migration, targeting MOSPD2 offers an advantage over targeting individual chemokine receptors, as it may overcome the redundancy issue that has limited the clinical translation of chemokine receptor-targeted therapies .

  • How does MOSPD2 contribute to cancer cell migration and metastasis?

    MOSPD2 functions as a key regulator of cancer cell migration and metastasis through several mechanisms:

    • Chemotaxis Regulation: Silencing MOSPD2 in different breast cancer cell lines significantly inhibits cancer cell chemotaxis migration in vitro, particularly in response to EGF stimulation .

    • Signaling Cascade Modulation: MOSPD2 knockdown profoundly reduces phosphorylation events that are involved in breast tumor cell chemotaxis .

    • Metastatic Capacity: In vivo experiments have demonstrated that MOSPD2-silenced breast cancer cells exhibit markedly impaired metastasis to the lungs .

    • Cell Proliferation: Interestingly, while MOSPD2 is crucial for cell migration, its targeting does not affect cancer cell proliferation , suggesting it specifically regulates metastatic spread rather than primary tumor growth.

    Methodologically, researchers can study MOSPD2's role in cancer using trans-well migration assays with sh-MOSPD2 transduced cells. Typically, 3×10^5 cells (previously starved for 3 hrs in 0.5% FBS/RPMI-1640) are seeded in the upper chamber of a QCM migration plate with 5 μm pores, followed by incubation with 10% FBS/RPMI-1640 and EGF (20-200ng/ml) for 24 hours .

  • What is the role of MOSPD2 in membrane contact site formation?

    MOSPD2 functions as a novel tethering protein at membrane contact sites (MCS) where the ER meets other organelles:

    • FFAT Motif Binding: The MSP domain of MOSPD2 binds to FFAT motifs present in proteins on target organelles with micromolar affinity, similar to VAP proteins .

    • Membrane Tethering: In vitro tethering assays using dynamic light scattering have demonstrated that the MSP domain of MOSPD2 can connect liposomes bearing FFAT-containing peptides to liposomes covered by the MSP domain, resulting in particle aggregation with high polydispersity (479 ± 87 nm) .

    • Organelle Contacts: MOSPD2 mediates contacts between the ER and various organelles including endosomes, mitochondria, and the Golgi .

    • Contact Site Formation: MOSPD2 contributes specifically to ER-endosome contacts, even in the absence of VAP proteins, and its depletion leads to an increase in endosome-endosome contacts .

    For investigating membrane contact sites, researchers can use fluorescence microscopy to visualize MOSPD2 enrichment at contact sites between the ER and organelles marked by FFAT-containing proteins like STARD3 (endosomes) or PTPIP51 (mitochondria) .

  • How can MOSPD2 be effectively silenced or knocked out in experimental models?

    Several approaches have been successfully employed to silence or knock out MOSPD2:

    • shRNA Approach: Lentiviral particles targeting different exons (particularly exon 4 and exon 14) have been used to silence MOSPD2 in human monocytes and breast cancer cell lines, with targeting exon 4 showing higher efficiency .

    • Knockout Mouse Model: MOSPD2 knockout mice have been generated using homologous recombination in embryonic stem cells. Since related family members (MOSPD1 and MOSPD3) may be implicated in development, careful design of the targeting construct is essential. The neomycin selection cassette is flanked by FRT sites to avoid interference with the MOSPD2 endogenous promoter that could potentially affect embryonic development .

    • Neutralizing Antibodies: Monoclonal antibodies against MOSPD2 have been developed by immunizing rabbits with recombinant human MOSPD2 (approximately 0.25 mg) emulsified in complete Freund's adjuvant followed by three boosts with incomplete Freund's adjuvant. These antibodies can be isolated from serum using protein A/G beads .

    When designing MOSPD2 silencing experiments, researchers should include appropriate controls and validation methods to confirm knockdown efficiency, such as Western blotting or quantitative PCR.

  • What are the differences between MOSPD2 and VAP proteins in membrane contact site formation?

    Despite sharing functional similarities, MOSPD2 and VAP proteins (VAP-A and VAP-B) exhibit important differences:

    • Abundance: Quantitative immunoblotting in HeLa cells has revealed significant differences in protein abundance: VAP-A is the most abundant, with VAP-B and MOSPD2 being thirty and two hundred times less abundant, respectively .

    • Functional Redundancy: In some contexts, MOSPD2 can maintain membrane contact sites even in the absence of VAP proteins, suggesting partial functional redundancy .

    • Contact Site Specificity: MOSPD2 contributes specifically to ER-endosome contacts, and this function appears independent of VAP proteins. In contrast, the requirement for VAP proteins in MCS formation appears to be cell type- and context-dependent .

    • Affinity for FFAT Motifs: Despite their differences, both MOSPD2 and VAPs bind FFAT motifs with similar micromolar affinities (KD values of 0.6-0.7 μM) .

    This differential abundance and specificity suggests that despite using similar interaction mechanisms, the relative concentration of these proteins might regulate the dynamics of membrane contact site formation in different cellular contexts.

  • How can recombinant MOSPD2 protein domains be produced for in vitro studies?

    Production of recombinant MOSPD2 domains, particularly the MSP domain, has been successfully achieved using the following approach:

    • Expression System: Escherichia coli has been used for the expression of the MSP domain of MOSPD2 .

    • Protein Design: Researchers have successfully expressed wild-type MSP domains as well as mutant versions (e.g., R404D/L406D) that are unable to bind FFAT motifs .

    • Purification: Standard protein purification techniques, followed by validation of purity using SDS-PAGE with Coomassie blue staining .

    • Functional Validation: The functionality of purified proteins can be assessed using binding assays with FFAT peptides. For example, streptavidin beads coupled to FFAT or control peptides can be used to test the binding specificity of recombinant MOSPD2 domains .

    For advanced binding studies, isothermal titration calorimetry (ITC) can be employed to measure the binding affinity (KD) between the MSP domain of MOSPD2 and FFAT peptides, which has been determined to be in the micromolar range, similar to VAP proteins .

  • What methodologies can be used to study MOSPD2-dependent membrane tethering?

    Several experimental approaches have been employed to study MOSPD2's role in membrane tethering:

    • Dynamic Light Scattering (DLS): This technique monitors tethering by recording the size of particles formed when two liposome populations interact - one bearing FFAT-containing peptides (attached via MPB-PE lipids) and another covered by the MSP domain of MOSPD2 (bound via DOGS-NTA-Ni2+ lipids) .

    • Pull-down Assays: Recombinant MSP domains (wild-type or mutant) can be immobilized on Ni2+ resin and incubated with protein extracts from cells expressing FFAT-containing proteins (e.g., STARD3) or their defective mutants (e.g., STARD3 FA/YA) .

    • Immunofluorescence Microscopy: This approach visualizes the enrichment of MOSPD2 at contact sites between organelles. For example, MOSPD2 localization can be examined relative to STARD3-positive endosomes or PTPIP51-positive mitochondria .

    • Electron Microscopy: This technique allows direct visualization of membrane contact sites, defined as regions where two distinct organelle membranes are separated by a short spacing .

    These complementary approaches provide a comprehensive toolkit for investigating the molecular mechanisms of MOSPD2-mediated membrane tethering both in vitro and in cellular contexts.

  • What is the significance of MOSPD2 in CNS inflammation?

    MOSPD2 has been identified as a potential therapeutic target for the treatment of CNS inflammation . While the search results provide limited details on this specific aspect, the established role of MOSPD2 in regulating monocyte migration suggests several potential mechanisms:

    • Myeloid Cell Infiltration: Given that MOSPD2 regulates monocyte migration, it may control the infiltration of inflammatory myeloid cells into the CNS during inflammatory conditions.

    • Blood-Brain Barrier Crossing: MOSPD2 might be involved in the process by which monocytes cross the blood-brain barrier, a critical step in CNS inflammation.

    • Knockout Model Insights: The development of MOSPD2 knockout mice provides a valuable tool for studying the role of this protein in CNS inflammation models.

    Researchers investigating MOSPD2 in CNS inflammation should consider employing these knockout models in established neuroinflammation paradigms and analyzing both cellular infiltration and inflammatory marker expression.

  • How does MOSPD2 affect endosome dynamics and interorganelle contacts?

    MOSPD2 plays a significant role in modulating endosome dynamics and interorganelle contacts:

    • ER-Endosome Contacts: MOSPD2 contributes to the formation of ER-endosome contacts, and its absence leads to a reduction in these contacts .

    • Endosome-Endosome Contacts: Interestingly, in the absence of MOSPD2, endosome-endosome contacts are specifically increased, revealing an alteration in endosome dynamics .

    • Mechanism: The precise mechanism by which MOSPD2 alters endosome dynamics remains unclear, though it likely involves the protein's ability to bind FFAT-containing proteins like STARD3 on endosomes .

    • Independence from VAPs: MOSPD2's function in ER-endosome contact formation appears to be independent of VAP proteins, highlighting its unique role in this process .

    These findings suggest that MOSPD2 may serve as a regulatory node in the complex network of interorganelle communications, with particular importance for endosome function and positioning.

  • What are the potential therapeutic implications of targeting MOSPD2?

    Targeting MOSPD2 shows promise for various therapeutic applications:

    • Anti-inflammatory Therapy: Given MOSPD2's role in monocyte migration, inhibiting this protein could potentially overcome the limitations faced by therapies targeting individual chemokine receptors, which have failed in clinical trials due to receptor redundancy .

    • Cancer Metastasis Prevention: The correlation between MOSPD2 expression and cancer progression, particularly in breast cancer, suggests that targeting this protein could inhibit metastatic spread without affecting primary tumor growth .

    • CNS Inflammation: MOSPD2 has been identified as a therapeutic target for CNS inflammation , suggesting applications in neurological disorders with inflammatory components.

    • Targeting Approaches: Several methods have been developed to target MOSPD2, including neutralizing antibodies , small molecule inhibitors (like VB-201, which inhibits signaling downstream to chemokine receptors) , and potentially gene silencing approaches.

    Researchers exploring MOSPD2 as a therapeutic target should consider both the protein's structural features (for small molecule design) and its cell surface expression (for antibody-based approaches), while also accounting for its differential expression across cell types to minimize off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.