Recombinant Human Motile sperm domain-containing protein 3 (MOSPD3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Motile sperm domain-containing protein 3 (MOSPD3), also known as CDS3 or NET30, is a protein encoded by the MOSPD3 gene in humans . It is characterized as a multi-pass membrane protein that includes a major sperm protein (MSP) domain . The mouse version of this gene, when deleted, has been linked to heart development issues and early death in newborns . Alternative versions of the transcript, which produce different protein forms, have been reported .

Gene and Protein Characteristics

AttributeDescription
Namemotile sperm domain containing 3
DescriptionEncodes a multi-pass membrane protein with a major sperm protein (MSP) domain
SynonymsNET30, CDS3
ProteinsMSPD3_HUMAN
NCBI Gene ID64598

Function and Interactions

MOSPD3 acts as a lipid transfer protein, facilitating the movement of sterols to the endosome and promoting membrane formation within endosomes, potentially at the expense of the cell membrane . It interacts with several proteins, including:

  • MOSPD2: Enhances the movement of monocytes and neutrophils in response to chemokines .

  • STARD3NL: Functions as a tethering protein between the endoplasmic reticulum and late endosomes .

  • OSBP: A lipid transporter involved in lipid exchange between the Golgi complex and endoplasmic reticulum membranes .

  • STARD3: Mediates cholesterol transport from the endoplasmic reticulum to endosomes .

  • VAPA and VAPB: Involved in vesicle trafficking and regulation of endoplasmic reticulum morphology .

MOSPD3, along with MOSPD1, shows a preference for FFNT motifs, which have fewer acidic elements . The FFAT motifs of proteins such as STARD3, MIGA2, and FIP200 contain a serine or threonine at the 4th position, and the phosphorylation of this residue is required for interaction with VAPA and VAPB, which is essential for creating membrane contact sites (MCS) .

Role in Fertility

Research indicates that multiple male reproductive tract-specific proteins, including some identified through CRISPR/Cas9 technology, regulate sperm migration through the oviduct in mice . These proteins play crucial roles in sperm function and could be targets for novel infertility treatments or contraceptives . While MOSPD3 is noted as a motile sperm domain-containing protein, its direct role in sperm motility enhancement has been explored in high-throughput screening platforms aimed at discovering compounds that enhance sperm motility .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOSPD3; Motile sperm domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
MOSPD3
Target Protein Sequence
MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNP TGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEG AEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSS FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT
Uniprot No.

Target Background

Gene References Into Functions
  1. Deletion of the Mospd3 locus is mutagenic; homozygous breeding results in a characteristic right ventricle defect and neonatal lethality in 50% of mice. PMID: 15533722
Database Links

HGNC: 25078

OMIM: 609125

KEGG: hsa:64598

STRING: 9606.ENSP00000223054

UniGene: Hs.521086

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MOSPD3 and what is its role in cellular biology?

MOSPD3 (Motile Sperm Domain-Containing Protein 3) is a member of the expanded VAP (VAMP-associated protein) family that plays a role in membrane contact site (MCS) formation between organelles. Unlike VAPA, VAPB, and MOSPD2 which interact with FFAT motifs, MOSPD3 preferentially binds to proteins containing FFNT (two phenylalanines in a Neutral Tract) motifs . MOSPD3 contains an MSP (Major Sperm Protein) domain that mediates these protein-protein interactions. Current research suggests MOSPD3 functions in the MOSPD1-MOSPD3 complex segregated from the VAPA-VAPB-MOSPD2 complex, potentially serving distinct cellular functions in membrane tethering .

How does MOSPD3 differ structurally from other members of the VAP family?

MOSPD3 contains an MSP domain that diverges significantly from those in VAPA, VAPB, and MOSPD2. While the hydrophobic pocket residues that accommodate the F2 and A5 positions of interaction motifs are largely conserved (V51, T54, V61, N64, K94, F95, and K125 in MOSPD1/MOSPD3), the residues that form electrostatic bridges with acidic elements are less conserved (such as K52 and R62) . This explains MOSPD3's preference for FFNT motifs rather than the acidic FFAT motifs preferred by VAPA/B and MOSPD2. The similarity between human MOSPD1 and human MOSPD3 is approximately 32% at protein levels , indicating significant evolutionary divergence while maintaining core functional domains.

What are the recommended expression systems for recombinant MOSPD3 production?

Based on available research, recombinant MOSPD3 can be successfully expressed in several systems:

Expression SystemTagsApplicationsAdvantagesChallenges
E. coliHis6, GSTProtein interaction studiesHigh yield, cost-effectivePotential lack of post-translational modifications
HEK-293 cellsHis, StrepFunctional studies, structural analysisProper folding, mammalian modificationsHigher cost, lower yield
Wheat germVariousWB, ELISA, AP, AACell-free system, reduced toxicity issuesLimited scale
Cell-free protein synthesisStrepELISA, WB, SDSRapid production, membrane proteinsLimited yield

For structural studies requiring proper folding and post-translational modifications, mammalian expression systems like HEK-293 cells are recommended . For basic binding studies or epitope mapping, E. coli expression may be sufficient. The choice of expression system should be determined by the specific downstream application and required protein quality .

What purification strategies are most effective for recombinant MOSPD3?

A standard purification protocol for His-tagged MOSPD3 involves:

  • Cell lysis in 50 mM Tris (pH 8), 300 mM NaCl, 1% Triton X-100, 10 mM 2-mercaptoethanol, 10 mM MgCl₂, with lysozyme and benzonase nuclease

  • Sonication (30% amplitude, 10-second pulses on/15-second pulses off)

  • IMAC NTA affinity chromatography

  • Elution with 500 mM imidazole in TBK buffer (pH 8.5) with 50% glycerol

  • Concentration using a 10 kDa cutoff device

  • Desalting against 40 mM Tris (pH 8.0), 100 mM KCl, and 10% glycerol

Protein purity should be confirmed by SDS-PAGE under reducing conditions (50 mM DTT) . For Strep-tagged variants, Strep-Tactin columns can be used following similar principles. Concentration can be calculated from absorbance at 280 nm, with expected concentrations greater than 0.5 mg/ml for properly expressed and purified protein .

How does MOSPD3 contribute to membrane contact site formation and what methodologies can be used to study this function?

MOSPD3 appears to function alongside MOSPD1 in a distinct complex from the VAPA-VAPB-MOSPD2 complex that mediates membrane contact sites. To study MOSPD3's role in MCS formation, researchers can employ several approaches:

  • Cryo-electron tomography (cryo-ET): This technique allows visualization of intact membrane structures and protein complexes at MCS. As demonstrated with VAP-A , cryo-ET can reveal the architecture of tethering complexes at nanoscale resolution.

  • In vitro membrane tethering assays: Using a system similar to that employed for MOSPD2 , researchers can assess MOSPD3's tethering capabilities:

    • Prepare two liposome populations: one bearing FFNT-containing peptides (LA) and another covered by recombinant MOSPD3 (LB)

    • Monitor tethering by dynamic light scattering (DLS)

    • Measure increases in particle size as evidence of tethering

    • Compare wild-type MOSPD3 with predicted binding-deficient mutants

  • Proximity labeling with BioID or TurboID: Fusing MOSPD3 with promiscuous biotin ligases can identify proteins in close proximity at MCS .

  • FRET/BRET assays: These can measure real-time interactions between MOSPD3 and potential partners at MCS in live cells.

Current understanding suggests MOSPD3 may be involved in forming specific types of MCS, with a preference for FFNT motif-containing proteins rather than the FFAT motif interactions that characterize VAPA/B and MOSPD2 .

What methodologies are recommended for studying MOSPD3 interactions with other proteins in the context of membrane biology?

To systematically study MOSPD3's interactions with other proteins, particularly in the context of membrane biology, several methodologies are recommended:

  • ChIP-quantitative PCR: This approach was successfully used to study protein-DNA interactions for related proteins and can be adapted to study MOSPD3 if it has any chromatin-associated functions.

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged MOSPD3 in relevant cell lines

    • Perform immunoprecipitation using tag-specific antibodies

    • Analyze co-precipitated proteins by mass spectrometry

    • Validate specific interactions with Western blotting

  • GFP-Trap and immunoprecipitation: For studying MOSPD3 interactions in living cells, GFP-tagged MOSPD3 can be expressed and pulled down using GFP-Trap beads .

  • Chromatin conformation capture assay: If MOSPD3 has potential roles in nuclear functions like its related protein MOSPD1 .

  • Reconstituted membrane systems:

    • Incorporate MOSPD3 into proteoliposomes

    • Mix with liposomes containing potential interacting proteins

    • Assess interaction through liposome tethering assays

    • Visualize using cryo-electron microscopy

  • Biomolecular fluorescence complementation (BiFC): Split fluorescent proteins fused to MOSPD3 and potential partners can visualize interactions in live cells.

When interpreting results, consider that MOSPD3 belongs to a family of proteins with similar functions, so specificity controls using related proteins (VAPA, VAPB, MOSPD1, MOSPD2) are essential to differentiate specific from general interactions.

How can researchers determine if MOSPD3 is implicated in disease pathologies, particularly neurodegenerative disorders?

Given MOSPD3's potential role in membrane contact sites and its mention in Alzheimer's disease-related research , several methodologies can be employed to investigate its involvement in disease states:

  • Expression analysis in pathological samples:

    • Perform immunohistochemical staining of MOSPD3 in disease versus control tissues

    • Conduct RT-qPCR to quantify MOSPD3 transcript levels

    • Analyze publicly available transcriptomic datasets for differential expression in disease conditions

  • Meta-analysis of gene expression data:

    • Integrate existing microarray and RNA-Seq datasets from human disease samples

    • Compare MOSPD3 expression across different neurological disorders

    • Calculate correlation coefficients between MOSPD3 and known disease genes

  • Genetic association studies:

    • Screen for MOSPD3 mutations or SNPs in patient cohorts

    • Perform case-control studies to identify potential associations

    • Use existing GWAS datasets to look for MOSPD3 locus associations

  • Functional assays in disease models:

    • Develop MOSPD3 knockout or knockdown models in relevant cell types

    • Assess effects on disease-relevant phenotypes (protein aggregation, etc.)

    • Perform rescue experiments with wild-type versus mutant MOSPD3

  • Interactome analysis in disease context:

    • Identify MOSPD3 interaction partners in healthy versus diseased states

    • Look for altered interactions with disease-associated proteins

    • Determine if disease-associated proteins contain FFNT motifs

In Alzheimer's disease research, MOSPD3 was identified as a gene perturbed in both asymptomatic AD brain and AD patient blood samples , suggesting it may serve as part of a biomarker panel for early disease detection.

What are the optimal experimental approaches for designing site-directed mutagenesis studies of MOSPD3?

Based on structure-function analyses of related proteins, a methodical approach to MOSPD3 mutagenesis includes:

  • Sequence alignment and structural prediction:

    • Align MOSPD3 with VAPA, VAPB, MOSPD1, and MOSPD2

    • Identify conserved residues in the MSP domain

    • Focus on residues likely involved in FFNT binding based on homology

  • Selection of mutation targets:

    • Key residues in the hydrophobic pocket (V51, T54, V61, N64, K94, F95, K125)

    • Residues forming electrostatic interactions (K52, R62)

    • The equivalent of RD/LD mutant sites identified in MOSPD2

  • Mutagenesis protocol:

    • Use KOD-Plus-Neo polymerase for amplification

    • Design mutagenic primers with 15-20 base pair overlaps

    • Digest with DpnI to remove template DNA

    • Transform into E. coli

    • Confirm mutations by Sanger sequencing

  • Functional validation:

    • Express wild-type and mutant proteins

    • Compare binding to FFNT-containing peptides using pull-down assays

    • Measure binding affinities using SPR

    • Assess membrane tethering capabilities in vitro

    • Evaluate cellular localization and function in vivo

What experimental design would best elucidate the distinct functions of MOSPD3 versus other VAP family members?

To distinguish MOSPD3's specific functions from other VAP family members, a comprehensive experimental approach is required:

  • Comparative depletion studies:

    • Generate single and combinatorial knockdowns/knockouts of VAP family proteins

    • Assess effects on different MCS using quantitative electron microscopy

    • Measure changes in lipid transfer and calcium signaling at MCS

    • Evaluate cellular phenotypes specific to each depletion

  • Rescue experiments:

    • Deplete endogenous MOSPD3 and attempt rescue with:

      • Wild-type MOSPD3

      • Chimeric proteins (MOSPD3 MSP domain with VAPA/B transmembrane domain)

      • MOSPD3 with mutations in key binding residues

    • Quantify restoration of MCS formation and function

  • Proteomics approach:

    • Perform IP-MS on each VAP family member

    • Create Venn diagrams of interacting proteins

    • Identify MOSPD3-specific versus shared interactors

    • Validate key interactions with co-IP and functional assays

  • Interactome mapping:

    • Use BioID or TurboID proximity labeling with each VAP family member

    • Compare proximity proteomes to identify distinct vs. overlapping networks

    • Validate with orthogonal methods (FRET, co-IP)

  • Subcellular localization analysis:

    • Perform super-resolution microscopy to map precise localization of each VAP member

    • Identify unique vs. overlapping distribution patterns

    • Correlate with MCS markers and partner proteins

Based on current evidence, MOSPD3 operates alongside MOSPD1 in a distinct complex from the VAPA-VAPB-MOSPD2 complex, with different binding preferences (FFNT vs. FFAT motifs) . This experimental design would help clarify whether this translates to distinct cellular functions and unique sets of interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.