Recombinant Human Mpv17-like protein 2 (MPV17L2)

What is the basic structure and localization of MPV17L2?

MPV17L2 is a hydrophobic protein of 176 amino acids with a molecular mass of approximately 20 kDa. Mitochondrial fractionation analyses have definitively demonstrated that MPV17L2 is an integral inner mitochondrial membrane protein. Unlike its paralog MPV17, MPV17L2 is dependent on mitochondrial DNA, as it is absent from ρ0 cells (cells lacking mtDNA) . The protein is encoded by a gene located on chromosome 19, band p13.11 . The full amino acid sequence is: MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD .

How does MPV17L2 differ from other members of the MPV17 family?

MPV17L2 belongs to a family of evolutionary conserved proteins that includes MPV17, MPV17L (MPV17-like protein), and PXMP2 (peroxisomal membrane protein 2). Phylogenetic analyses indicate that a gene duplication event before the radiation of eukaryotes produced an MPV17/L/L2 clade and a PXMP2 clade. Later gene duplication events early in metazoan evolution gave rise to the MPV17, MPV17L, and MPV17L2 clades .

• MPV17L2 is dependent on mtDNA and absent in ρ0 cells, while MPV17 persists in cells lacking mtDNA

• MPV17L2 co-sediments with the large subunit of the mitochondrial ribosome, while MPV17 does not

• MPV17 functions as a non-selective channel modulating membrane potential, while MPV17L2 is involved in ribosome assembly

What is the primary function of MPV17L2 in mitochondria?

MPV17L2 plays a critical role in mitochondrial ribosome biogenesis. Specifically, it contributes to the assembly and stability of the mitochondrial ribosome, uniting the two subunits to create the translationally competent monosome. Gene silencing experiments demonstrate that MPV17L2 is required for:

• The proper assembly of the mitochondrial ribosome

• The stability of both ribosomal subunits

• Efficient mitochondrial protein synthesis

• Proper organization of mitochondrial nucleoids

When MPV17L2 expression is reduced by RNA interference, the ribosome is disrupted and translation in the mitochondria is impaired. This indicates MPV17L2 plays an important role in ribosomal biogenesis in the organelle .

What are the most effective methods for studying MPV17L2's interactions with the mitochondrial ribosome?

Several complementary approaches have proven effective for investigating MPV17L2's interactions with the mitochondrial ribosome:

• Gradient Sedimentation Analysis:

  • Sucrose gradients can be used to separate mitochondrial ribosomes and determine co-sedimentation patterns

  • For proper analysis of monosome association, mitochondria should be isolated in EDTA-free buffer and disrupted in the presence of 20 mM magnesium before sedimentation on sucrose gradients

  • This approach revealed that MPV17L2 co-sediments with the large mitochondrial ribosomal subunit (mtLSU) and the monosome

• Immunoprecipitation:

  • Using tagged components of mitochondrial ribosomal subunits (e.g., ICT1-FLAG for mtLSU or MRPS27-FLAG for mtSSU)

  • This technique confirmed enrichment of endogenous MPV17L2 in immunoprecipitations using ICT1-FLAG (mtLSU component) but not with MRPS27-FLAG (mtSSU component)

• Iodixanol Gradient Analysis:

  • Helps resolve mitochondrial nucleoprotein complexes

  • Showed that MPV17L2 co-fractionates with mitochondrial nucleoids and depends on mtDNA presence

How can we effectively silence MPV17L2 expression to study its function?

RNA interference has been successfully used to reduce MPV17L2 expression. Specific siRNAs targeting MPV17L2 have been developed and validated. When implementing this approach:

• At least three different specific siRNAs should be tested to control for off-target effects

• Non-target dsRNA oligonucleotides should be used as controls

• Effectiveness of knockdown should be verified by Western blot

• Phenotypic effects should be analyzed 48-72 hours post-transfection

The silencing of MPV17L2 leads to several observable phenotypes that can be measured:

• Enlarged nodules in the mitochondrial network (visible by fluorescence microscopy)

• Mitochondrial swelling and loss of cristae (observable by electron microscopy)

• Abnormal nucleoid aggregation (detectable by immunocytochemistry)

• Decreased mitochondrial translation (measurable by metabolic labeling)

What approaches can be used to study the effects of MPV17L2 depletion on mitochondrial translation?

Several complementary approaches can be employed:

• Metabolic Labeling of Nascent Mitochondrial Proteins:

  • Cells are pulse-labeled with 35S-methionine/cysteine in the presence of emetine (to inhibit cytoplasmic translation)

  • Newly synthesized mitochondrial proteins are separated by SDS-PAGE and visualized by autoradiography

  • This approach revealed markedly reduced synthesis of nascent mitochondrial proteins in cells with silenced MPV17L2

• Western Blot Analysis of OXPHOS Components:

  • Levels of both nuclear and mitochondrially encoded components of the OXPHOS system can be measured

  • MPV17L2 gene silencing produces marked decreases in these components

• Analysis of Mitochondrial Ribosomal Proteins:

  • Western blot analysis of mtLSU and mtSSU components

  • Sucrose gradient fractionation to assess ribosome assembly

  • These techniques showed that MPV17L2 knockdown affects both ribosomal subunits and dramatically reduces monosome formation

How does MPV17L2 contribute to the coordination between mitochondrial ribosome assembly and nucleoid organization?

The relationship between MPV17L2, mitochondrial ribosomes, and nucleoid organization represents a complex and intriguing area of research. Current evidence suggests:

• MPV17L2 depletion causes mitochondrial DNA aggregation, with enlarged nucleoids visible by immunocytochemistry

• In the absence of MPV17L2, proteins of the small subunit of the mitochondrial ribosome become trapped in the enlarged nucleoids

• This trapping effect is not observed for components of the large subunit

• These findings suggest that assembly of the small subunit of the mitochondrial ribosome may occur at the nucleoid

This data points to MPV17L2 playing a crucial role in coordinating spatial organization of mitochondrial translation machinery with the nucleoid, potentially serving as a bridge between mtDNA maintenance and expression. Further research using super-resolution microscopy and proximity labeling techniques could help elucidate these spatial relationships more precisely.

What is the mechanistic basis for MPV17L2's role in mitochondrial ribosome assembly?

While MPV17L2 clearly influences mitochondrial ribosome assembly, the precise molecular mechanism remains to be fully elucidated. Current research suggests:

• MPV17L2 primarily associates with the large mitochondrial ribosomal subunit (mtLSU)

• It appears to be required for the joining of the small and large subunits to form the monosome

• In the absence of MPV17L2, components of both subunits are destabilized, but some assembled mtLSU remains

• This residual mtLSU always contains MPV17L2, suggesting there are no mtLSUs lacking MPV17L2

Several possible mechanisms can be hypothesized:

• MPV17L2 may serve as a scaffolding protein that facilitates subunit interaction

• It might induce conformational changes in the mtLSU that promote monosome formation

• It could regulate the timing of ribosome assembly in coordination with other factors

Research comparing MPV17L2's function to known ribosome assembly factors like C7orf30 could help distinguish between these possibilities.

How does MPV17L2 depletion affect mitochondrial membrane dynamics and organelle morphology?

Gene silencing of MPV17L2 has significant effects on mitochondrial ultrastructure:

• After downregulation of MPV17L2 expression, prominent protrusions or nodules appear in the mitochondrial network

• Electron microscopy reveals that these mitochondria are enlarged with sparse or completely absent cristae

• In some mitochondria, the cristae appear swollen, which may precede complete cristae loss

• The enlarged nodules coincide with high concentrations of mtDNA, indicating impaired mtDNA distribution or segregation

These morphological changes suggest that MPV17L2, beyond its role in ribosome assembly, may influence mitochondrial membrane architecture and dynamics. The mechanism could involve:

• Altered mitochondrial translation affecting membrane protein composition

• Disrupted nucleoid-membrane interactions

• Changes in mitochondrial fusion/fission processes due to altered protein synthesis

Further research using time-lapse microscopy of mitochondria in MPV17L2-depleted cells could help understand the progression of these morphological changes.

How conserved is MPV17L2 function across species, and what can we learn from evolutionary studies?

Phylogenetic analysis indicates that the MPV17 family has a complex evolutionary history:

• A gene duplication event before the radiation of eukaryotes produced an MPV17/L/L2 clade and a PXMP2 clade

• Later gene duplication events early in metazoan evolution gave rise to the separate MPV17, MPV17L, and MPV17L2 clades

• MPV17L2 shows higher sequence conservation across species than MPV17L, as reflected in shorter branch lengths in phylogenetic trees

Interesting insights come from comparative studies:

• Budding yeast has a single mitochondrial MPV17 homologue, Sym1

• Experiments with HA-tagged Sym1 revealed that, unlike human MPV17L2, Sym1 does not associate with mitochondrial ribosomes

• This suggests that MPV17L2 likely gained a new function after the gene duplication event

These evolutionary differences may explain why mutations in different family members cause distinct phenotypes across species. Further studies comparing MPV17L2 function across a wider range of species could help identify core conserved functions versus species-specific adaptations.

What distinctions exist between MPV17L2 and its paralog MPV17 regarding their roles in mitochondrial function?

Despite their sequence similarity, MPV17L2 and MPV17 have distinct functions in mitochondria:

These differences highlight how gene duplication and subsequent specialization have allowed these related proteins to evolve distinct but potentially complementary roles in mitochondrial function .

What is known about the potential role of MPV17L2 in disease pathogenesis?

• Given MPV17L2's essential role in mitochondrial ribosome assembly and protein synthesis, disruptions to its function would likely have serious consequences for cellular energy metabolism

• The effects of MPV17L2 silencing (impaired mitochondrial translation, disrupted nucleoid organization, and abnormal mitochondrial morphology) resemble features seen in mitochondrial disorders

• Research has shown that MPV17L2 is downregulated by miR-34a-5p, and this downregulation disrupts the assembly of mitochondrial respiratory chain complexes, reduces mitochondrial respiration capacity, increases oxidative stress, and enhances apoptotic cell death

These findings suggest that alterations in MPV17L2 expression or function could contribute to mitochondrial dysfunction in various pathological contexts, particularly conditions involving defective mitochondrial translation or oxidative stress.

How might targeting MPV17L2 be relevant for understanding mitochondrial dysfunction in disease?

MPV17L2 represents an interesting target for understanding broader aspects of mitochondrial dysfunction in disease:

• It provides a direct link between mitochondrial ribosome function and nucleoid organization, two critical aspects of mitochondrial biology that are often disrupted in mitochondrial disorders

• Its dependence on mtDNA makes it a potential sensor or mediator of responses to mtDNA depletion or damage

• Its interaction with the mitochondrial translation machinery positions it as a potential regulator of mitochondrial protein synthesis, which is frequently compromised in mitochondrial diseases

Research approaches that could leverage MPV17L2 for disease insights include:

• Analyzing MPV17L2 expression and localization in patient samples from various mitochondrial disorders

• Investigating potential genetic variants affecting MPV17L2 function in patients with undiagnosed mitochondrial dysfunction

• Developing cellular models with controlled MPV17L2 expression to study mitochondrial stress responses

What are the challenges in producing and working with recombinant MPV17L2?

Working with recombinant MPV17L2 presents several technical challenges that researchers should consider:

• Protein Solubility and Stability:

  • MPV17L2 is a hydrophobic integral membrane protein, which complicates expression and purification

  • Recombinant expression systems must be carefully optimized to maintain proper folding and stability

  • Storage conditions are critical; the protein should be kept at -80°C and aliquoted to avoid repeated freeze-thaw cycles

• Expression Systems:

  • Wheat germ cell-free expression systems have been successfully used for producing human MPV17L2

  • When expressed in bacterial systems, inclusion body formation may be a concern due to the protein's hydrophobicity

  • Mammalian expression systems may provide better post-translational modifications but with lower yield

• Functionality Assessment:

  • As an integral membrane protein, assessing the functionality of recombinant MPV17L2 requires reconstitution into a suitable membrane environment

  • Artificial membrane systems or proteoliposomes may be needed to study the protein's native functions

  • Activity assays should focus on measuring ribosome binding capacity rather than enzymatic activity

What are the best approaches for detecting endogenous MPV17L2 in experimental systems?

Several complementary approaches have proven effective for detecting endogenous MPV17L2:

• Western Blotting:

  • MPV17L2 appears as a protein of approximately 20 kD on Western blots

  • Mitochondrial enrichment is recommended before analysis to improve detection sensitivity

  • Proper controls should include MPV17L2-negative cells to confirm antibody specificity

• Immunofluorescence Microscopy:

  • MPV17L2 can be detected by immunofluorescence in fixed cells

  • Co-staining with mitochondrial markers (such as MTCO2) helps confirm localization

  • Super-resolution microscopy may be needed to distinguish sublocalization within mitochondria

• Fractionation Approaches:

  • Sucrose gradient fractionation of mitochondrial extracts allows detection of MPV17L2 associated with ribosomal subunits

  • Iodixanol gradients can be used to co-localize MPV17L2 with nucleoids

  • For optimal fractionation results, mitochondria should be isolated in EDTA-free buffer and disrupted in the presence of 20 mM magnesium

The choice of detection method depends on the specific experimental question, with combined approaches often providing the most comprehensive insights.

What are the most promising areas for future research on MPV17L2?

Several key areas warrant further investigation to advance our understanding of MPV17L2:

• Structural Studies:

  • Determining the 3D structure of MPV17L2, particularly in complex with the mitochondrial ribosome

  • Investigating structural changes upon binding to the ribosome

  • Comparing structural features with other MPV17 family members to understand functional divergence

• Regulatory Mechanisms:

  • Identifying factors that regulate MPV17L2 expression and localization

  • Understanding how MPV17L2 responds to mitochondrial stress

  • Exploring potential post-translational modifications that might regulate its function

  • Further investigating the regulation of MPV17L2 by miRNAs, particularly miR-34a-5p

• Interactome Mapping:

  • Comprehensive identification of MPV17L2 protein interaction partners beyond ribosomal proteins

  • Investigating potential interactions with mtDNA maintenance factors

  • Examining possible functional relationships with other mitochondrial inner membrane proteins

• Physiological Roles in Different Tissues:

  • Analyzing tissue-specific expression patterns and functions

  • Investigating potential specialized roles in highly metabolic tissues

  • Examining developmental regulation, as suggested by expression data in model organisms like Xenopus

These research directions would significantly advance our understanding of MPV17L2's role in mitochondrial biology and potentially reveal new therapeutic targets for mitochondrial disorders.

How might emerging technologies enhance our understanding of MPV17L2 function?

Several cutting-edge technologies could significantly advance MPV17L2 research:

• Cryo-Electron Microscopy:

  • High-resolution structural analysis of MPV17L2 in complex with the mitochondrial ribosome

  • Visualization of conformational changes during ribosome assembly

  • Identification of specific interaction interfaces between MPV17L2 and ribosomal components

• CRISPR-Based Approaches:

  • Generation of conditional knockout models to study tissue-specific functions

  • Base editing to introduce disease-relevant mutations

  • CRISPRi/CRISPRa systems for temporal control of expression

  • CRISPR screens to identify synthetic lethal interactions

• Advanced Imaging Techniques:

  • Super-resolution microscopy to precisely localize MPV17L2 within mitochondria

  • Live-cell imaging with tagged MPV17L2 to monitor dynamics during mitochondrial stress

  • Correlative light and electron microscopy (CLEM) to connect MPV17L2 localization with ultrastructural features

  • Proximity labeling approaches to map spatial relationships within the mitochondrion

• Single-Cell Omics:

  • Analysis of cell-to-cell variability in MPV17L2 expression and its consequences

  • Integration of transcriptomics, proteomics, and metabolomics data

  • Examination of mitochondrial heterogeneity in relation to MPV17L2 function

These technological approaches could reveal new insights into MPV17L2's function and its role in mitochondrial homeostasis that are not accessible with conventional techniques.